DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE4 and clic2

DIOPT Version :9

Sequence 1:NP_611326.1 Gene:GstE4 / 37109 FlyBaseID:FBgn0063496 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_001002561.2 Gene:clic2 / 436834 ZFINID:ZDB-GENE-040718-299 Length:239 Species:Danio rerio


Alignment Length:194 Identity:47/194 - (24%)
Similarity:77/194 - (39%) Gaps:35/194 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 LLTLKALDLPFEFVFVNLFEKENFSEDFSKKNPQHTVPLLQDDDACIWDSHAIMAYLVEKYAPSD 83
            :|.||.  :.|....|::.:|.:..:|.:   |....|.|..:.....|...|..:|....||  
Zfish    38 VLWLKG--VKFTVTTVDMRKKPDELKDLA---PGTNPPFLLYNGTLKTDFIKIEEFLETTLAP-- 95

  Fly    84 ELYPKDLLQRAKVDQLMHFESGV-IFE--SALRRLTRPVLFFGEPTLPRNQVDHILQVYDFVETF 145
            ..|| .|..|.|..    |:.|. ||.  ||..: ..|...|.|..|.|    ...::.|::.|.
Zfish    96 PRYP-HLSPRYKES----FDVGADIFAKFSAFIK-NSPNNAFHEKALLR----EFKRLDDYLNTP 150

  Fly   146 LDD----------HDFVAGDQLTIADFSIVSTITSIGV----FLELD-PAKYPKIAAWLERLKE 194
            |.|          ..|:.|::||:||.:::..:..|.|    :...| |.::..:..:|:...|
Zfish   151 LQDELDQNISVSKRKFLDGNRLTLADCNLLPKLHVIKVAARKYCNFDIPTQFTGVWRYLQSAYE 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE4NP_611326.1 GST_N_Delta_Epsilon 4..77 CDD:239343 13/57 (23%)
GstA 6..196 CDD:223698 47/194 (24%)
GST_C_Delta_Epsilon 91..209 CDD:198287 29/122 (24%)
clic2NP_001002561.2 O-ClC 11..238 CDD:129941 47/194 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589565
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.