DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE4 and GstD11

DIOPT Version :9

Sequence 1:NP_611326.1 Gene:GstE4 / 37109 FlyBaseID:FBgn0063496 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_001138040.1 Gene:GstD11 / 41512 FlyBaseID:FBgn0038029 Length:243 Species:Drosophila melanogaster


Alignment Length:225 Identity:86/225 - (38%)
Similarity:122/225 - (54%) Gaps:17/225 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 GKIS---LYGLDASPPTRACLLTLKALDLPFEFVFVNLFEKENFSEDFSKKNPQHTVPLLQDDDA 63
            ||:|   ||.|..|||.|:.||..|.||:.||...||:.|.|....||...||||.||.:.|:..
  Fly    20 GKMSPPVLYYLPPSPPCRSILLLAKMLDIDFELKIVNILEGEQLKPDFVAMNPQHCVPTMNDEGL 84

  Fly    64 CIWDSHAIMAYLVEKYAPSDELYPKDLLQRAKVDQLMHFESGVIFESALRRLTR---PVLFFGEP 125
            .:|:|.||::|||..|..||:|||.|:..||.|||.:.|:.|.::    .|||.   |.:|.|.|
  Fly    85 VLWESRAILSYLVAAYGKSDQLYPTDIRVRALVDQRLQFDLGTLY----MRLTDYYFPTMFIGAP 145

  Fly   126 TLPRNQVDHILQVYDFVETFLDDHDFVAGDQLTIADFSIVSTITSIGVF-LELDPAKYPKIAAWL 189
             |...:...:.:...::.|.|:...|.|.|..||||.:::.|::.:..| .||.|  |..|..||
  Fly   146 -LDEGKRAKLAEAVGWLNTILEGRQFSAADHFTIADLTLLVTVSQLEAFEFELRP--YKHIRQWL 207

  Fly   190 ERLKE--LPY-YEEANGKGAAQFVELLRSK 216
            :|.|:  .|: |||.|...|....::.::|
  Fly   208 DRCKDHMAPFDYEELNANKANMLADMFKAK 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE4NP_611326.1 GST_N_Delta_Epsilon 4..77 CDD:239343 34/75 (45%)
GstA 6..196 CDD:223698 76/195 (39%)
GST_C_Delta_Epsilon 91..209 CDD:198287 41/124 (33%)
GstD11NP_001138040.1 GST_N_Delta_Epsilon 25..98 CDD:239343 33/72 (46%)
GST_C_Delta_Epsilon 112..231 CDD:198287 41/125 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR43969
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
98.970

Return to query results.
Submit another query.