DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE4 and GstZ1

DIOPT Version :9

Sequence 1:NP_611326.1 Gene:GstE4 / 37109 FlyBaseID:FBgn0063496 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_649894.1 Gene:GstZ1 / 41132 FlyBaseID:FBgn0037696 Length:246 Species:Drosophila melanogaster


Alignment Length:175 Identity:45/175 - (25%)
Similarity:80/175 - (45%) Gaps:37/175 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 FSEDFSKKNPQHTVPLLQDDDACIWDSHAIMAYLVEKYAPSDELYPKDLLQRAKVDQLMHFE-SG 105
            :::::.:.||...||.|:.|...:.||.||:.|| |:..|...|.|:|.::|||:.:::... ||
  Fly    75 YTDEYREVNPMQKVPSLKIDGHTLCDSVAIIHYL-EETRPQPALLPQDPVKRAKIREIVELICSG 138

  Fly   106 VIFESALRRLTRPVLFFGEPTLPRNQVDHI-----LQ--------VYDFVETFLDDHD---FVAG 154
            :                 :|....:.:|||     ||        .:..:|..| .|.   |..|
  Fly   139 I-----------------QPLQNVSVLDHIGKDQSLQWAQHWISRGFQGLEKVL-SHSAGKFCVG 185

  Fly   155 DQLTIADFSIVSTITSIGVFLELDPAKYPKIAAWLERLKELPYYE 199
            |:|::||..:|..:.:...: :.|...||.|....:.|:||..::
  Fly   186 DELSMADICLVPQVRNARRY-KADLTPYPTIVRLNQELQELDVFK 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE4NP_611326.1 GST_N_Delta_Epsilon 4..77 CDD:239343 12/34 (35%)
GstA 6..196 CDD:223698 44/170 (26%)
GST_C_Delta_Epsilon 91..209 CDD:198287 28/126 (22%)
GstZ1NP_649894.1 GST_N_Zeta 34..109 CDD:239340 12/34 (35%)
maiA 35..240 CDD:273527 45/175 (26%)
GST_C_Zeta 122..236 CDD:198300 28/127 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460400
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.