DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE4 and gfzf

DIOPT Version :9

Sequence 1:NP_611326.1 Gene:GstE4 / 37109 FlyBaseID:FBgn0063496 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_001014610.1 Gene:gfzf / 40858 FlyBaseID:FBgn0250732 Length:1045 Species:Drosophila melanogaster


Alignment Length:204 Identity:68/204 - (33%)
Similarity:110/204 - (53%) Gaps:9/204 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 ISLYGLDASPPTRACLLTLKALDLPFEFVFVNLFEKENFSEDFSKKNPQHTVPLLQDDDACIWDS 68
            :.||.:...||:.|..:||||||:.::.:.|:....|:.||::||.|||..:|:|.||...:.:|
  Fly   812 MKLYAVSDGPPSLAVRMTLKALDIQYQLINVDFCAMEHRSEEYSKMNPQKEIPVLDDDGFYLSES 876

  Fly    69 HAIMAYLVEKYAPSDELYPKDLLQRAKVDQLMHFESGVIFESALRRLTRPVLF-FGEPTLPRNQV 132
            .|||.||.:||||...|||:|:..||.::|.:.|..|..:.........|:.| :....:...:|
  Fly   877 IAIMQYLCDKYAPDSTLYPQDVNVRAVINQRLCFNMGFYYAPISAHSMAPIFFDYKRTPMSLKKV 941

  Fly   133 DHILQVYDFVETFLD--DHDFVAGDQLTIADFSIVSTITSIGVFLELDPAKYPKIAAWLERLK-E 194
            .:.|.|:   ||:|.  ...:.||:.:|||||:::|....:.. :..|..::..:..|.|..| |
  Fly   942 QNALDVF---ETYLQRLGTKYAAGENITIADFALISATICLEA-INFDLHQFTLVNKWYETFKVE 1002

  Fly   195 LP-YYEEAN 202
            .| .:|.||
  Fly  1003 YPQLWEIAN 1011

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE4NP_611326.1 GST_N_Delta_Epsilon 4..77 CDD:239343 30/72 (42%)
GstA 6..196 CDD:223698 64/193 (33%)
GST_C_Delta_Epsilon 91..209 CDD:198287 30/117 (26%)
gfzfNP_001014610.1 FLYWCH 18..87 CDD:282369
FLYWCH 162..229 CDD:282369
FLYWCH 365..432 CDD:282369
FLYWCH 597..663 CDD:282369
Thioredoxin_like 811..886 CDD:294274 30/73 (41%)
GstA 812..1000 CDD:223698 62/191 (32%)
GST_C_Delta_Epsilon 900..1017 CDD:198287 30/116 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 54 1.000 Domainoid score I643
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR43969
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
87.920

Return to query results.
Submit another query.