DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE4 and gstt1b

DIOPT Version :9

Sequence 1:NP_611326.1 Gene:GstE4 / 37109 FlyBaseID:FBgn0063496 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_956878.1 Gene:gstt1b / 393556 ZFINID:ZDB-GENE-040426-1491 Length:242 Species:Danio rerio


Alignment Length:197 Identity:53/197 - (26%)
Similarity:105/197 - (53%) Gaps:23/197 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 SPPTRACLLTLKALDLPFEFVFVNLFEKENFSEDFSKKNPQHTVPLLQDDDACIWDSHAIMAYLV 76
            |.|.|:..:..|..::.|::..::|||...:.|:|.|.||....|.::|.|.|:.:|.|||.||.
Zfish    11 SQPCRSVYIFAKKNNIQFDYKKISLFEGYQYGEEFGKINPLRKFPTIKDGDFCLAESVAIMIYLA 75

  Fly    77 EKYAPSDELYPKDLLQRAKVDQLMHFESGVIFESALRRLTRPVLFFG-------EPTLPRNQVDH 134
            :|:...|..:|.||.:||:|::.:.::     .:::|.....:::|.       ...:|:.::::
Zfish    76 DKFHTPDHWFPADLQKRARVNEYLSWQ-----HTSIRMHGAKIIWFKILIPEVLGAEVPKEKMEN 135

  Fly   135 -------ILQVYDFVETFLDDHDFVAGDQLTIADF-SIVSTITSIGVFLELDPAKYPKIAAWLER 191
                   .||:  |.:.||.|..|:.|||:::||. :||..:......:::...: ||:.||.:|
Zfish   136 AEENLNVALQL--FQDKFLQDKPFIVGDQISLADLVAIVEIMQPFAAGMDVFENR-PKLKAWKDR 197

  Fly   192 LK 193
            ::
Zfish   198 VR 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE4NP_611326.1 GST_N_Delta_Epsilon 4..77 CDD:239343 23/64 (36%)
GstA 6..196 CDD:223698 53/197 (27%)
GST_C_Delta_Epsilon 91..209 CDD:198287 25/118 (21%)
gstt1bNP_956878.1 GstA 1..199 CDD:223698 53/195 (27%)
GST_N_Theta 3..78 CDD:239348 23/66 (35%)
GST_C_Theta 91..217 CDD:198292 25/117 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.720

Return to query results.
Submit another query.