Sequence 1: | NP_611326.1 | Gene: | GstE4 / 37109 | FlyBaseID: | FBgn0063496 | Length: | 222 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_956878.1 | Gene: | gstt1b / 393556 | ZFINID: | ZDB-GENE-040426-1491 | Length: | 242 | Species: | Danio rerio |
Alignment Length: | 197 | Identity: | 53/197 - (26%) |
---|---|---|---|
Similarity: | 105/197 - (53%) | Gaps: | 23/197 - (11%) |
- Green bases have known domain annotations that are detailed below.
Fly 12 SPPTRACLLTLKALDLPFEFVFVNLFEKENFSEDFSKKNPQHTVPLLQDDDACIWDSHAIMAYLV 76
Fly 77 EKYAPSDELYPKDLLQRAKVDQLMHFESGVIFESALRRLTRPVLFFG-------EPTLPRNQVDH 134
Fly 135 -------ILQVYDFVETFLDDHDFVAGDQLTIADF-SIVSTITSIGVFLELDPAKYPKIAAWLER 191
Fly 192 LK 193 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
GstE4 | NP_611326.1 | GST_N_Delta_Epsilon | 4..77 | CDD:239343 | 23/64 (36%) |
GstA | 6..196 | CDD:223698 | 53/197 (27%) | ||
GST_C_Delta_Epsilon | 91..209 | CDD:198287 | 25/118 (21%) | ||
gstt1b | NP_956878.1 | GstA | 1..199 | CDD:223698 | 53/195 (27%) |
GST_N_Theta | 3..78 | CDD:239348 | 23/66 (35%) | ||
GST_C_Theta | 91..217 | CDD:198292 | 25/117 (21%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0625 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1231780at2759 | |
OrthoFinder | 1 | 1.000 | - | - | FOG0000035 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 1 | 0.900 | - | - | OOG6_100130 | |
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 1 | 1.000 | - | - | X30 | |
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
6 | 5.720 |