DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE4 and GstO1

DIOPT Version :10

Sequence 1:NP_611326.1 Gene:GstE4 / 37109 FlyBaseID:FBgn0063496 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_648237.1 Gene:GstO1 / 38975 FlyBaseID:FBgn0035907 Length:254 Species:Drosophila melanogaster


Alignment Length:259 Identity:59/259 - (22%)
Similarity:98/259 - (37%) Gaps:87/259 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 GKISLYGLDASPPTRACLLTLKALDLPFEFVFVNLFEKENFSEDFSKKNPQHTVPLL----QDDD 62
            |.:.||.:...|......|.|.|..:|:..:::||.:|   .|.||..:....||.|    :..:
  Fly    20 GILKLYSMRFCPYAHRVHLVLDAKKIPYHAIYINLRDK---PEWFSLVSSSTKVPALELVKEQGN 81

  Fly    63 ACIWDSHAIMAYLVEKYAPSDELYPKDLLQRAK-----------------------VDQLM---H 101
            ..:.:|..|..||.||| |...|||||||::|:                       .:||:   |
  Fly    82 PVLIESLIICDYLDEKY-PEVPLYPKDLLKKAQEKILIERFGQFINAFYYLLLHDNPEQLVDTDH 145

  Fly   102 FESGVIFESALRRLTRPVLFFGEPTLPRNQVDHIL---------QVYDFVETFLDDHDFVAGDQL 157
            :...|::|..|:|  |...|||..:  ...:|:::         ..|.|.:.|            
  Fly   146 YAGLVVYEEELKR--RCTKFFGGDS--PGMLDYMMWPWCERFDSLKYTFEQKF------------ 194

  Fly   158 TIADFSIVSTITSIGVFLELDPAKYPKIAAWLERLKELPYYEEA------NGKGAAQFVELLRS 215
                              ||.|.::|.:..|    ::|...:.|      :|:..|:::...||
  Fly   195 ------------------ELSPERFPTLIKW----RDLMIQDRAVKCFYLDGQTHAKYMNSRRS 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE4NP_611326.1 GstA 6..209 CDD:440390 56/247 (23%)
GstO1NP_648237.1 Protein Disulfide Oxidoreductases and Other Proteins with a Thioredoxin fold 3..95 CDD:469754 20/77 (26%)
GST_C_Omega 109..234 CDD:198293 26/162 (16%)

Return to query results.
Submit another query.