DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE4 and se

DIOPT Version :9

Sequence 1:NP_611326.1 Gene:GstE4 / 37109 FlyBaseID:FBgn0063496 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_648235.1 Gene:se / 38973 FlyBaseID:FBgn0086348 Length:243 Species:Drosophila melanogaster


Alignment Length:253 Identity:64/253 - (25%)
Similarity:100/253 - (39%) Gaps:79/253 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 GKISLYGLDASPPTRACLLTLKALDLPFEFVFVNLFEKENFSEDFSKKNPQHTVPLL----QDDD 62
            |.:.||.:...|..:...|.|.|..:|:..:::||.:|   .|...:||||..||.|    :...
  Fly    20 GILRLYSMRFCPFAQRVHLVLDAKQIPYHSIYINLTDK---PEWLLEKNPQGKVPALEIVREPGP 81

  Fly    63 ACIWDSHAIMAYLVEKYAPSDELYPKDLLQRAKVDQLM---------------------HFESGV 106
            ..:.:|..|..||.|:| |...|||:|.|::.: |:|:                     .|.||:
  Fly    82 PVLTESLLICEYLDEQY-PLRPLYPRDPLKKVQ-DKLLIERFRAVLGAFFKASDGGDLEPFWSGL 144

  Fly   107 -IFESALRRLTRPVLFFGEPTLPRNQVDHILQVYDFVETFLDDHDFVAGDQLTIADFSIVSTITS 170
             |:|..|.|  |...|||                              |:|..|.|:.|......
  Fly   145 DIYERELAR--RGTEFFG------------------------------GEQTGILDYMIWPWCER 177

  Fly   171 I-------GVFLELDPAKYPKIAAWLERLKELP----YYEEANGKGAAQFVELLRSKN 217
            :       |.....|.:::|::..||||:|..|    :|.||..:     .|.||:::
  Fly   178 LELLKLQRGEDYNYDQSRFPQLTLWLERMKRDPAVMAFYMEAEVQ-----AEFLRTRS 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE4NP_611326.1 GST_N_Delta_Epsilon 4..77 CDD:239343 22/76 (29%)
GstA 6..196 CDD:223698 56/222 (25%)
GST_C_Delta_Epsilon 91..209 CDD:198287 31/150 (21%)
seNP_648235.1 GST_N_Omega 3..95 CDD:239353 22/77 (29%)
GstA 22..215 CDD:223698 57/229 (25%)
GST_C_Omega 109..229 CDD:198293 34/157 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460161
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.