DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE4 and GstO3

DIOPT Version :10

Sequence 1:NP_611326.1 Gene:GstE4 / 37109 FlyBaseID:FBgn0063496 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_648234.1 Gene:GstO3 / 38972 FlyBaseID:FBgn0035904 Length:241 Species:Drosophila melanogaster


Alignment Length:226 Identity:54/226 - (23%)
Similarity:85/226 - (37%) Gaps:71/226 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 GKISLYGLDASPPTRACLLTLKALDLPFEFVFVNLFEKENFSEDFSKKNPQHTVPLLQ----DDD 62
            |.:.||.:...|..:...|.|.|.::|:..|::||.||..:..:.|   |...||.||    ..:
  Fly    20 GVLRLYSMRFCPYAQRAHLVLNAKNVPYHSVYINLTEKPEWLVEVS---PLLKVPALQLVAEKGE 81

  Fly    63 ACIWDSHAIMAYLVEKYAPSDELYPKDLLQRAKVDQLMHFESGV--------------------- 106
            ..:.:|..|..||.:|| |.:.|.|||.|:||:...|:...|.:                     
  Fly    82 PSLIESLIIAEYLDDKY-PENPLLPKDPLKRAQDKILLERFSSITSAFINILVQGTGLEDYWTAL 145

  Fly   107 -IFESALRRLTRPVLFFGEPTLPRNQVDHILQVYDFVETFLDDHDFVAGDQLTIADFSIVSTITS 170
             |||..|.:...|  :||                              |::....|:.|......
  Fly   146 DIFEEELTKRGTP--YFG------------------------------GNKPGFVDYMIWPWFER 178

  Fly   171 IGVFLEL--------DPAKYPKIAAWLERLK 193
            :.| :||        :.:::|||..|:..||
  Fly   179 LSV-IELKLQKEYNFNESRFPKITKWIALLK 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE4NP_611326.1 GstA 6..209 CDD:440390 53/222 (24%)
GstO3NP_648234.1 Protein Disulfide Oxidoreductases and Other Proteins with a Thioredoxin fold 3..95 CDD:469754 22/77 (29%)
GST_C_Omega 109..230 CDD:198293 24/133 (18%)

Return to query results.
Submit another query.