DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE4 and GstE11

DIOPT Version :9

Sequence 1:NP_611326.1 Gene:GstE4 / 37109 FlyBaseID:FBgn0063496 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_001286575.1 Gene:GstE11 / 37128 FlyBaseID:FBgn0034354 Length:225 Species:Drosophila melanogaster


Alignment Length:211 Identity:80/211 - (37%)
Similarity:132/211 - (62%) Gaps:3/211 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LYGLDASPPTRACLLTLKALDLPFEFVFVNLFEKENFSEDFSKKNPQHTVPLLQDDDACIWDSHA 70
            ||....|||.||.|||..||.|..:...||:...|:.|.:|.|.|.|||:|:|.|:...:.|||.
  Fly     7 LYYAPRSPPCRAVLLTAAALGLELDLRLVNVKAGEHKSAEFLKLNAQHTIPVLDDNGTIVSDSHI 71

  Fly    71 IMAYLVEKYAP--SDELYPKDLLQRAKVDQLMHFESGVIFESALRRLTRPVLFFGEPTLPRNQVD 133
            |.:||.:||||  .|.|||||..:|..||..::::.|.:| ..:|.:..||::||...:|.::|.
  Fly    72 ICSYLADKYAPEGDDSLYPKDPEKRRLVDARLYYDCGHLF-PRIRFIVEPVIYFGAGEVPSDRVA 135

  Fly   134 HILQVYDFVETFLDDHDFVAGDQLTIADFSIVSTITSIGVFLELDPAKYPKIAAWLERLKELPYY 198
            ::.:.||.:|..|.:.|::.||:|||||.|.::::::...|..::|.::|::..|::|::.||||
  Fly   136 YLQKAYDGLEHCLAEGDYLVGDKLTIADLSCIASVSTAEAFAPIEPDQFPRLVQWVKRIQALPYY 200

  Fly   199 EEANGKGAAQFVELLR 214
            ::.|.:|....|.|::
  Fly   201 QKNNQEGLDMLVGLVK 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE4NP_611326.1 GST_N_Delta_Epsilon 4..77 CDD:239343 32/70 (46%)
GstA 6..196 CDD:223698 72/191 (38%)
GST_C_Delta_Epsilon 91..209 CDD:198287 36/117 (31%)
GstE11NP_001286575.1 GstA 5..198 CDD:223698 72/191 (38%)
GST_N_Delta_Epsilon 5..78 CDD:239343 32/70 (46%)
GST_C_Delta_Epsilon 94..211 CDD:198287 36/117 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468020
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D118089at33392
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 1 0.900 - - OOG6_100130
Panther 1 1.100 - - P PTHR43969
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
1110.800

Return to query results.
Submit another query.