DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE4 and GstE13

DIOPT Version :9

Sequence 1:NP_611326.1 Gene:GstE4 / 37109 FlyBaseID:FBgn0063496 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_001188889.1 Gene:GstE13 / 35928 FlyBaseID:FBgn0033381 Length:226 Species:Drosophila melanogaster


Alignment Length:208 Identity:83/208 - (39%)
Similarity:127/208 - (61%) Gaps:3/208 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGKISLYGLDASPPTRACLLTLKALDLPFEFVFVNLFEKENFSEDFSKKNPQHTVPLLQDDDACI 65
            |.|.:||....|||.|||:|..|.:.|..|...|:..:||:.||:|.|.||||.:|:..|.|..:
  Fly     1 MSKPTLYYALFSPPARACILVAKLIGLDLELKPVDFAKKEHLSEEFVKLNPQHQIPVFVDSDGEV 65

  Fly    66 W-DSHAIMAYLVEKYAPSDELYPKDLLQRAKVDQLMHFESGVIFESALRRLTRPVLFFGEPTLPR 129
            : |||||:.:||.|||.:|:|||:||.:||.:|..||:|:||:|: .::.:....::.||.....
  Fly    66 YVDSHAIVCFLVAKYAGNDQLYPRDLKRRAHIDHRMHYENGVLFQ-VVKDIVARNIYGGEGEYNP 129

  Fly   130 NQVDHILQVYDFVETFLDDHDFVAGDQLTIADFSIVSTITSIGVFLELDPAKYPKIAAWLERL-K 193
            ..:......|..:|.||....||.|::|::||.||.:|:.::.:.:.::..|||:...|:||: |
  Fly   130 RSLTLCHNAYSDLEHFLQQGSFVVGNELSVADVSIHTTLVTLDLLIPVEREKYPQTKQWMERMDK 194

  Fly   194 ELPYYEEANGKGA 206
            .||..||.|.|||
  Fly   195 LLPDNEEINLKGA 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE4NP_611326.1 GST_N_Delta_Epsilon 4..77 CDD:239343 32/73 (44%)
GstA 6..196 CDD:223698 73/191 (38%)
GST_C_Delta_Epsilon 91..209 CDD:198287 39/117 (33%)
GstE13NP_001188889.1 GST_N_Delta_Epsilon 4..78 CDD:239343 32/73 (44%)
GST_C_Delta_Epsilon 92..211 CDD:198287 39/117 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468000
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D118089at33392
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR43969
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
109.900

Return to query results.
Submit another query.