DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE4 and GstT3

DIOPT Version :9

Sequence 1:NP_611326.1 Gene:GstE4 / 37109 FlyBaseID:FBgn0063496 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_001162808.1 Gene:GstT3 / 33047 FlyBaseID:FBgn0031117 Length:268 Species:Drosophila melanogaster


Alignment Length:210 Identity:65/210 - (30%)
Similarity:105/210 - (50%) Gaps:28/210 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 SPPTRACLLTLKALDLPFEFVFVNLFEKENFSEDFSKK-NPQHTVPLLQDDDACIWDSHAIMAYL 75
            |.|:||..:..:..::|||...|.|...|:.:|||.|: |....||.:.|:...:.:|.||:.||
  Fly    53 SQPSRALFIIFRLSNMPFEDCVVALRNGEHLTEDFKKEINRFQRVPCIHDNGYKLAESVAILRYL 117

  Fly    76 VEKYAPSDELYPKDLLQRAKVDQLMHFESGVIFESALRRLTRPVLF---FGEPTLP--------- 128
            ..|....:.||||..:.:::||:.:.::...:      |||..:.|   :.||.|.         
  Fly   118 SAKGKIPEHLYPKYFVDQSRVDEFLEWQHMSL------RLTCAMYFRTVWLEPLLTGRTPSEAKI 176

  Fly   129 ---RNQVDHILQVYDFVETFLDDHDFVAGDQLTIADFSIVSTITSIGVFLELD-PAKYPKIAAWL 189
               |.|::..|.|.:  |.:|:..||:.|..||:||......|....: .:.| ..|||||.|||
  Fly   177 ETFRMQMERNLDVVE--EVWLEGKDFLTGSSLTVADIFAACEIEQTRM-ADYDVRIKYPKIRAWL 238

  Fly   190 ERLKEL--PYYEEAN 202
            :|:::.  |||:.|:
  Fly   239 KRVRQSCNPYYDVAH 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE4NP_611326.1 GST_N_Delta_Epsilon 4..77 CDD:239343 23/65 (35%)
GstA 6..196 CDD:223698 61/202 (30%)
GST_C_Delta_Epsilon 91..209 CDD:198287 37/130 (28%)
GstT3NP_001162808.1 GST_N_Theta 45..121 CDD:239348 23/67 (34%)
GstA 47..243 CDD:223698 61/198 (31%)
GST_C_Theta 135..259 CDD:198292 37/128 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460073
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
76.650

Return to query results.
Submit another query.