DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE4 and clic1

DIOPT Version :9

Sequence 1:NP_611326.1 Gene:GstE4 / 37109 FlyBaseID:FBgn0063496 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_997847.1 Gene:clic1 / 324481 ZFINID:ZDB-GENE-030131-3202 Length:241 Species:Danio rerio


Alignment Length:210 Identity:43/210 - (20%)
Similarity:72/210 - (34%) Gaps:69/210 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 PPTRACLLTLKALDLPFEFVFVNLFEKENFSEDFSKKNPQHTVPLLQDDDACIWDSHAIMAYLVE 77
            |.::...:.|....:.|....|::..|....:|.:   |....|.|........|::.|..:|.|
Zfish    25 PFSQRLFMVLWLKGVTFNVTTVDMKRKPEILKDLA---PGAQPPFLLYGTEVKTDTNKIEEFLEE 86

  Fly    78 KYAPSDELYPK-------------DLLQRAKV----------DQLMHFESGVIFESALRRLTRPV 119
            ...|..  ||:             |:..:...          |.|   |.|::  .||::|..  
Zfish    87 TLCPPK--YPRLAACNPESNTAGLDVFSKFSAYIKNSNPQMNDNL---EKGLL--KALKKLDD-- 142

  Fly   120 LFFGEPTLP----RNQVDHILQVYDFVETFLDDHDFVAGDQLTIAD------------------- 161
             :...| ||    .|..|.::   ....:|||      |.:||:||                   
Zfish   143 -YLSSP-LPDEIDENSADDVI---SSTRSFLD------GQELTLADCNLLPKLHIVKVVCLKFRG 196

  Fly   162 FSIVSTITSIGVFLE 176
            |||..::||:..:|:
Zfish   197 FSIPRSLTSLWRYLD 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE4NP_611326.1 GST_N_Delta_Epsilon 4..77 CDD:239343 12/63 (19%)
GstA 6..196 CDD:223698 43/210 (20%)
GST_C_Delta_Epsilon 91..209 CDD:198287 26/119 (22%)
clic1NP_997847.1 GST_N_CLIC 3..93 CDD:239359 14/72 (19%)
O-ClC 6..241 CDD:129941 43/210 (20%)
GST_C_CLIC1 100..238 CDD:198333 27/130 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589698
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.