DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE4 and Gdap1l1

DIOPT Version :9

Sequence 1:NP_611326.1 Gene:GstE4 / 37109 FlyBaseID:FBgn0063496 Length:222 Species:Drosophila melanogaster
Sequence 2:XP_038961050.1 Gene:Gdap1l1 / 311616 RGDID:1304960 Length:369 Species:Rattus norvegicus


Alignment Length:175 Identity:35/175 - (20%)
Similarity:67/175 - (38%) Gaps:36/175 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 NPQH-----------TVPLLQDDDACIWDSHAIMAYLVEKYAPSDELYPKDLLQRAKVD--QLMH 101
            :|||           .:|:......||.........::.|||.::   .:..|..|..|  :|.|
  Rat   139 SPQHARVLQYRELLDALPMDAYTHGCILHPELTTDSMIPKYATAE---IRRHLANATTDLMKLDH 200

  Fly   102 FESGVI--FESALRRLTRPVLFFGEPTLPRNQVDHILQVYDFVETFLDDHD----------FVAG 154
            .|..:.  :.|..::|...:|...:....:..:..:..|.|.:|..|:...          ::.|
  Rat   201 EEPQLSEPYLSKQKKLMAKILEHDDVGYLKKILGELAMVLDQIEAELEKRKLENEGQTCELWLCG 265

  Fly   155 DQLTIADFSIVSTITSIGVFLELDPAKY------PKIAAWLERLK 193
            ...|:||..:.:|:..: .||.|. .||      |.:.::.||::
  Rat   266 CAFTLADVLLGATLHRL-KFLGLS-KKYWEDGSRPNLQSFFERVQ 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE4NP_611326.1 GST_N_Delta_Epsilon 4..77 CDD:239343 6/37 (16%)
GstA 6..196 CDD:223698 35/175 (20%)
GST_C_Delta_Epsilon 91..209 CDD:198287 26/123 (21%)
Gdap1l1XP_038961050.1 Thioredoxin_like 47..122 CDD:412351
GST_C_family 203..313 CDD:413470 20/108 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166348271
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.