DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE4 and Gsto2

DIOPT Version :9

Sequence 1:NP_611326.1 Gene:GstE4 / 37109 FlyBaseID:FBgn0063496 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_001012071.1 Gene:Gsto2 / 309465 RGDID:1310764 Length:248 Species:Rattus norvegicus


Alignment Length:217 Identity:44/217 - (20%)
Similarity:86/217 - (39%) Gaps:49/217 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 GKISLYGLDASPPTRACLLTLKALDLPFEFVFVNLFEKENFSEDFSKKNPQHTVPLLQDDDA-CI 65
            |.|.:|.:...|.:....|.|||..:..|.:.:||..|.::   :..|:|...||:|::... .|
  Rat    22 GVIRIYSMRFCPYSHRTRLVLKAKSIRHEIININLKNKPDW---YYTKHPFGQVPVLENSQCQLI 83

  Fly    66 WDSHAIMAYLVEKYAPSDELYPKDLLQRAKVDQLMHFESGVIFESALRRLTRPVLFFGEPTLP-- 128
            ::|.....||.:.: |..:|:|.|..:||:...|:.                  ||...|.|.  
  Rat    84 YESVIACEYLDDVF-PGRKLFPYDPYERARQKMLLE------------------LFCKVPQLSKE 129

  Fly   129 ------------------RNQVDHILQVYDFVETFLDDHDFVAGDQLTIADFSIVSTITSIGVFL 175
                              |.::.::.::.::..|     .|..||.:::.|:.:......:.|:.
  Rat   130 CLVALRCGRDCTDLKVALRQELCNLEEILEYQNT-----TFFGGDSISMIDYLVWPWFERLDVYG 189

  Fly   176 ELDPAKY-PKIAAWLERLKELP 196
            ..|...: |.:..|:..:|:.|
  Rat   190 LADCVNHTPMLRLWISSMKQDP 211

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GstE4NP_611326.1 GST_N_Delta_Epsilon 4..77 CDD:239343 20/73 (27%)
GstA 6..196 CDD:223698 41/211 (19%)
GST_C_Delta_Epsilon 91..209 CDD:198287 19/127 (15%)
Gsto2NP_001012071.1 GST_N_Omega 7..94 CDD:239353 20/74 (27%)