DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE4 and Clic6

DIOPT Version :10

Sequence 1:NP_611326.1 Gene:GstE4 / 37109 FlyBaseID:FBgn0063496 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_788267.2 Gene:Clic6 / 304081 RGDID:727938 Length:613 Species:Rattus norvegicus


Alignment Length:169 Identity:40/169 - (23%)
Similarity:65/169 - (38%) Gaps:26/169 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 LLTLKALDLPFEFVFVNLFEKENFSEDFSKKNPQHTVPLLQDDDACIWDSHAIMAYLVEKYAPSD 83
            :|.||.  :.|....|:|..|   ..|.....|....|.:..|.....|.:.|..:|.||..|  
  Rat   405 ILWLKG--VIFNVTTVDLKRK---PADLQNLAPGTNPPFMTFDGEVKTDVNKIEEFLEEKLVP-- 462

  Fly    84 ELYPKDLLQR-----AKVDQLMHFESGV---------IFESALRRLTRPVLFFGEPTLPRNQVDH 134
            ..|||...|.     |..|....|.:.:         |:|..|.|..:.:..:....|| :::| 
  Rat   463 PRYPKLGTQHPESNSAGNDVFAKFSAFIKNTKKDANDIYEKNLLRALKKLDSYLNSPLP-DEID- 525

  Fly   135 ILQVYDFVETFLDDHDFVAGDQLTIADFSIVSTITSIGV 173
               .|...:..:....|:.||:||:||.:::..:..|.:
  Rat   526 ---AYSTEDVTVSQRKFLDGDELTLADCNLLPKLHIIKI 561

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE4NP_611326.1 GstA 6..209 CDD:440390 40/169 (24%)
Clic6NP_788267.2 2A1904 <51..318 CDD:273344
O-ClC 380..613 CDD:129941 40/169 (24%)
G-site. /evidence=ECO:0000250|UniProtKB:Q9Y696 396..399
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.