DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE4 and Clic4

DIOPT Version :10

Sequence 1:NP_611326.1 Gene:GstE4 / 37109 FlyBaseID:FBgn0063496 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_038913.1 Gene:Clic4 / 29876 MGIID:1352754 Length:253 Species:Mus musculus


Alignment Length:175 Identity:39/175 - (22%)
Similarity:65/175 - (37%) Gaps:38/175 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 LLTLKALDLPFEFVFVNLFEKENFSEDFSKKNPQHTVPLLQDDDACIWDSHAIMAYLVEKYAPSD 83
            :|.||.  :.|....|:|..|   ..|.....|....|.:..:.....|.:.|..:|.|...|  
Mouse    44 ILWLKG--VVFSVTTVDLKRK---PADLQNLAPGTHPPFITFNSEVKTDVNKIEEFLEEVLCP-- 101

  Fly    84 ELYPKDLLQRAKVDQLMHFESGV----IFE--SALRRLTRPVLFFGEPTLPRNQVDHILQVYDFV 142
               ||.|....|     |.||..    ||.  ||..:.:||.   ....|.|..:..:.::.:::
Mouse   102 ---PKYLKLSPK-----HPESNTAGMDIFAKFSAYIKNSRPE---ANEALERGLLKTLQKLDEYL 155

  Fly   143 ETFLDD--------------HDFVAGDQLTIADFSIVSTITSIGV 173
            .:.|.|              ..|:.||::|:||.:::..:..:.|
Mouse   156 NSPLPDEIDENSMEDIKFSTRRFLDGDEMTLADCNLLPKLHIVKV 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE4NP_611326.1 GstA 6..209 CDD:440390 39/175 (22%)
Clic4NP_038913.1 Required for insertion into the membrane. /evidence=ECO:0000250 2..101 14/61 (23%)
O-ClC 17..252 CDD:129941 39/175 (22%)
G-site. /evidence=ECO:0000250|UniProtKB:Q9Z0W7 35..38
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.