DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE4 and GSTT4

DIOPT Version :9

Sequence 1:NP_611326.1 Gene:GstE4 / 37109 FlyBaseID:FBgn0063496 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_001345593.1 Gene:GSTT4 / 25774 HGNCID:26930 Length:241 Species:Homo sapiens


Alignment Length:200 Identity:55/200 - (27%)
Similarity:92/200 - (46%) Gaps:23/200 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 ISLYGLDASPPTRACLLTLKALDLPFEFVFVNLFEKENFSEDFSKKNPQHTVPLLQDDDACIWDS 68
            :.||....|.|.||..:..|..|:.|.|.||:|.:..:.|:.:...||...:|.|:|....:.:|
Human     3 LELYMDLLSAPCRAVYIFSKKHDIQFNFQFVDLLKGHHHSKGYIDINPLRKLPSLKDGKFILSES 67

  Fly    69 HAIMAYLVEKYAPSDELYPKDLLQRAKVDQLMHFESGVIFESALRRLTRPVLFF----GEPTLPR 129
            .||:.||..||:......|.|...||:||:.:.::. ..|:..::::....|..    ||.....
Human    68 AAILYYLCRKYSAPSHWCPPDPHARARVDEFVAWQH-TAFQLPMKKIVWLKLLIPKITGEEVSAE 131

  Fly   130 ------NQVDHILQVYDFVETFLDDHDFVAGDQLTIADFSIVSTI-----TSIGVFLELDPAKYP 183
                  .:|.:.||:::  |.||.|..|:.|:|:::||...|..:     .:..|||...     
Human   132 KMEHAVEEVKNSLQLFE--EYFLQDKMFITGNQISLADLVAVVEMMQPMAANYNVFLNSS----- 189

  Fly   184 KIAAW 188
            |:|.|
Human   190 KLAEW 194

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GstE4NP_611326.1 GST_N_Delta_Epsilon 4..77 CDD:239343 24/72 (33%)
GstA 6..196 CDD:223698 54/197 (27%)
GST_C_Delta_Epsilon 91..209 CDD:198287 26/112 (23%)
GSTT4NP_001345593.1 Thioredoxin_like 3..78 CDD:320948 24/74 (32%)