DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE4 and gst2

DIOPT Version :9

Sequence 1:NP_611326.1 Gene:GstE4 / 37109 FlyBaseID:FBgn0063496 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_588517.1 Gene:gst2 / 2539601 PomBaseID:SPCC965.07c Length:230 Species:Schizosaccharomyces pombe


Alignment Length:243 Identity:69/243 - (28%)
Similarity:107/243 - (44%) Gaps:43/243 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGKISLYGLDASPPTRACLLTLKALDLPFEFVFVNLFEKENFSEDFSKKNPQHTVPLLQD---DD 62
            |...:||.....|.....:|.||.|:|.:|.:|.:..:.|...::....||...||.|.|   :|
pombe     1 MAHFTLYSHAGGPNPWKVVLALKELNLSYEQIFYDFQKGEQKCKEHLALNPNGRVPTLVDHKNND 65

  Fly    63 ACIWDSHAIMAYLVEKYAPSDEL-YPKDLLQRAKVDQLMHFES---GVIFESA--LRRLTRPVLF 121
            ..||:|.||:.||.:||....:: ...|..:..|:.|.:.|::   |||:..|  ..      .|
pombe    66 YTIWESDAILIYLADKYDTDRKISLSFDDPEYYKLIQYLFFQASGQGVIWGQAGWFN------FF 124

  Fly   122 FGEP-----TLPRNQVDHILQVYDFVETFLDDHDFVAGDQLTIADFSIVSTITSIGVFL------ 175
            ..||     |..||::..:|.|   :|..|.|.|::..::.||||.|.:....::|...      
pombe   125 HHEPVVSAVTRYRNEIKRVLGV---LEDILKDRDYLVANKYTIADLSFIPWNYNLGGLFGEGKFS 186

  Fly   176 ------ELDPAK-YPKIAAWLERLKELPYYEEANGKGAAQFVELLRSK 216
                  :||..| :||..||.:||...|..:       |.|.||.::|
pombe   187 FKEEVPQLDFEKEFPKAYAWNQRLLARPAVK-------ATFEELAKAK 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE4NP_611326.1 GST_N_Delta_Epsilon 4..77 CDD:239343 25/75 (33%)
GstA 6..196 CDD:223698 62/216 (29%)
GST_C_Delta_Epsilon 91..209 CDD:198287 36/140 (26%)
gst2NP_588517.1 GST_N_Ure2p_like 4..84 CDD:239346 27/79 (34%)
GstA 5..226 CDD:223698 67/236 (28%)
GST_C_Ure2p 96..219 CDD:198326 35/138 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 80 1.000 Inparanoid score I1854
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm9258
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
TreeFam 00.000 Not matched by this tool.
87.760

Return to query results.
Submit another query.