DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE4 and gst1

DIOPT Version :9

Sequence 1:NP_611326.1 Gene:GstE4 / 37109 FlyBaseID:FBgn0063496 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_588298.1 Gene:gst1 / 2538694 PomBaseID:SPCC191.09c Length:229 Species:Schizosaccharomyces pombe


Alignment Length:247 Identity:71/247 - (28%)
Similarity:109/247 - (44%) Gaps:53/247 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGKISLYGLDASPPTRACLLTLKALDLPFEFVFVNLFEKENFSEDFSKKNPQHTVPLLQD---DD 62
            |.:.:|:.....|.....:..||.|||.:|..:||..:.|..|.:....||...||.|.|   :|
pombe     1 MAQFTLWSHAHGPNPWKVVQALKELDLTYETRYVNFSKNEQKSPEHLALNPNGRVPTLIDHHNND 65

  Fly    63 ACIWDSHAIMAYLVEKYAPSDEL-YPKDLLQRAKVDQLMHFES---GVIF-----------ESAL 112
            ..||:|.||:.||.:||....:: .|:|..:..||.|.:.|::   |:|:           |..:
pombe    66 YTIWESDAILIYLADKYDTERKISLPRDHPEYYKVIQYLFFQASGQGIIWGQAGWFSVYHQELVI 130

  Fly   113 RRLTRPVLFFGEPTLPRNQVDHILQVYDFVETFLDDHDFVAGDQLTIADFSIVS------TITSI 171
            ..:||          .||::..:|.|   :|..|.|.|::..::.||||.|.:|      .|.:.
pombe   131 SAITR----------YRNEIKRVLGV---LEDILKDRDYLVANRFTIADLSFISWNNFLEIIFAE 182

  Fly   172 GVFL------ELDPAK-YPKIAAWLERLKELPYYEEANGKGAAQFVELLRSK 216
            |.|.      :||..| :|:..:|.:||...|       ...|.|.|  |||
pombe   183 GKFSIEEEVPQLDFEKEFPRTYSWHQRLLARP-------ASKATFEE--RSK 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE4NP_611326.1 GST_N_Delta_Epsilon 4..77 CDD:239343 26/75 (35%)
GstA 6..196 CDD:223698 63/220 (29%)
GST_C_Delta_Epsilon 91..209 CDD:198287 35/144 (24%)
gst1NP_588298.1 GST_N_Ure2p_like 3..84 CDD:239346 28/80 (35%)
GstA 5..218 CDD:223698 64/232 (28%)
GST_C_Ure2p 96..219 CDD:198326 34/142 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 80 1.000 Inparanoid score I1854
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm9258
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
TreeFam 00.000 Not matched by this tool.
87.760

Return to query results.
Submit another query.