DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE4 and Clic5

DIOPT Version :9

Sequence 1:NP_611326.1 Gene:GstE4 / 37109 FlyBaseID:FBgn0063496 Length:222 Species:Drosophila melanogaster
Sequence 2:XP_006524198.1 Gene:Clic5 / 224796 MGIID:1917912 Length:485 Species:Mus musculus


Alignment Length:173 Identity:42/173 - (24%)
Similarity:61/173 - (35%) Gaps:59/173 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 QHTVPLLQDDDACIWDSHAIMAYLVEKYAPSD--ELYPKDLLQRAKVDQ-------------LMH 101
            ||:..|....|:.|..|.||  .|.||.|.|.  |::   |..:|.:|.             ::.
Mouse   217 QHSKVLATSQDSSISLSAAI--GLGEKEAASSNPEIF---LFVKAGIDGESIGNCPFSQRLFMIL 276

  Fly   102 FESGVIFESALRRLTRPVLFFGEPTLPRNQVDHILQVYDFVETFLDDHDFVAGDQLTIADFS--I 164
            :..||:|......|.|      :|.                    |.|:...|.......|:  :
Mouse   277 WLKGVVFNVTTVDLKR------KPA--------------------DLHNLAPGTHPPFLTFNGDV 315

  Fly   165 VSTITSIGVFLE--LDPAKYPKIAAWLERLKELPYYEEANGKG 205
            .:.:..|..|||  |.|.||||:||         .:.|:|..|
Mouse   316 KTDVNKIEEFLEETLTPEKYPKLAA---------KHRESNTAG 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE4NP_611326.1 GST_N_Delta_Epsilon 4..77 CDD:239343 9/24 (38%)
GstA 6..196 CDD:223698 39/162 (24%)
GST_C_Delta_Epsilon 91..209 CDD:198287 27/132 (20%)
Clic5XP_006524198.1 O-ClC 248..483 CDD:129941 29/140 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167844833
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.