Sequence 1: | NP_611326.1 | Gene: | GstE4 / 37109 | FlyBaseID: | FBgn0063496 | Length: | 222 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_766057.1 | Gene: | Clic6 / 209195 | MGIID: | 2146607 | Length: | 596 | Species: | Mus musculus |
Alignment Length: | 199 | Identity: | 44/199 - (22%) |
---|---|---|---|
Similarity: | 73/199 - (36%) | Gaps: | 40/199 - (20%) |
- Green bases have known domain annotations that are detailed below.
Fly 19 LLTLKALDLPFEFVFVNLFEKENFSEDFSKKNPQHTVPLLQDDDACIWDSHAIMAYLVEKYAPSD 83
Fly 84 ELYPKDLLQR-----AKVDQLMHF---------ESGVIFESALRRLTRPVLFFGEPTLPRNQVDH 134
Fly 135 ILQVYDFVETFLDDHDFVAGDQLTIADFSIVSTITSIGVFLELDPAKYPKIAAWLERLKELPYYE 199
Fly 200 EANG 203 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
GstE4 | NP_611326.1 | GST_N_Delta_Epsilon | 4..77 | CDD:239343 | 14/57 (25%) |
GstA | 6..196 | CDD:223698 | 42/190 (22%) | ||
GST_C_Delta_Epsilon | 91..209 | CDD:198287 | 24/127 (19%) | ||
Clic6 | NP_766057.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..360 | ||
PHA02664 | <69..167 | CDD:177447 | |||
GST_N_CLIC | 360..448 | CDD:239359 | 17/66 (26%) | ||
O-ClC | 363..596 | CDD:129941 | 44/199 (22%) | ||
GST_C_CLIC6 | 455..594 | CDD:198334 | 23/125 (18%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C167844584 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |