DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE4 and gst-43

DIOPT Version :9

Sequence 1:NP_611326.1 Gene:GstE4 / 37109 FlyBaseID:FBgn0063496 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_491070.1 Gene:gst-43 / 190586 WormBaseID:WBGene00001791 Length:214 Species:Caenorhabditis elegans


Alignment Length:180 Identity:54/180 - (30%)
Similarity:90/180 - (50%) Gaps:11/180 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 LTLKALDLPFEFVFVNLFEKENFSE-DFSKKNPQHTVPLLQDDDACIWDSHAIMAYLVEKYAPSD 83
            |.||.:|  :|:..::||.:|:.:. :|.|.||...||.|..:...:.:|.||:.||.|.| |..
 Worm    22 LALKNID--YEYRPIDLFSEESKNNAEFVKHNPAKKVPTLVINGLSLTESLAIIEYLDEAY-PDP 83

  Fly    84 ELYPKDLLQRAKVDQL-MHFESGVIFESALRRLTRPVLFFGEPTLPRNQVDHIL-QVYDFVETFL 146
            ...||:|.:|:....: :|..:.:....|:.  ...:|...||.......:|.: :.:..:|..|
 Worm    84 PFLPKELDKRSYSRAIALHIVASIQPLQAIN--IHKMLNEKEPGYGDFWCNHFVNKGFLALEELL 146

  Fly   147 DDHD--FVAGDQLTIADFSIVSTITSIGVFLELDPAKYPKIAAWLERLKE 194
            ..|.  :..||||||||.::.|.|.:..:: ::|.:|||.|....|.|.|
 Worm   147 KKHSGKYCVGDQLTIADINLPSIIYNAKIY-KVDMSKYPTITRINEILAE 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE4NP_611326.1 GST_N_Delta_Epsilon 4..77 CDD:239343 20/57 (35%)
GstA 6..196 CDD:223698 54/180 (30%)
GST_C_Delta_Epsilon 91..209 CDD:198287 28/108 (26%)
gst-43NP_491070.1 GST_N_Zeta 4..77 CDD:239340 19/56 (34%)
maiA 5..211 CDD:273527 54/180 (30%)
GST_C_Zeta 90..207 CDD:198300 29/109 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160163446
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.