DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE4 and gst-14

DIOPT Version :9

Sequence 1:NP_611326.1 Gene:GstE4 / 37109 FlyBaseID:FBgn0063496 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_496861.1 Gene:gst-14 / 185409 WormBaseID:WBGene00001762 Length:210 Species:Caenorhabditis elegans


Alignment Length:189 Identity:51/189 - (26%)
Similarity:79/189 - (41%) Gaps:38/189 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 LPFEFVFVNLFEKENFSED----FSKKNPQHTVPLLQDDDACIWDSHAIMAYLVEKY-----APS 82
            :|||      .|:.||.:|    ...|.|...:|:|..||..|..|.||..||..|:     .|.
 Worm    27 VPFE------DERVNFLDDTWEKMKGKTPMGQLPVLTVDDFEIPQSAAINRYLARKFGFAGKTPE 85

  Fly    83 DELYPKDLLQRAKVDQLMHFESGVIFE------SALRRLTRPVLFFGEPTLPRNQVDHILQVYDF 141
            :|.:...::.:.| |....|...||.:      ..|.:||..|:   :|.         :.||..
 Worm    86 EEAWVDAVVDQFK-DFFAEFRKLVIAKRVGKSAEELEKLTAEVI---KPA---------MDVYFK 137

  Fly   142 VETFL---DDHDFVAGDQLTIADFSIVSTITSIGVFLELDPA-KYPKIAAWLERLKELP 196
            |...|   ....::.||.:|.||..|...|.::..:..|:.: :.||:||.||::...|
 Worm   138 VLNGLLEKSKSGYLIGDSITFADLYIADNIQTLKKYGLLEASGEQPKLAAHLEKVYSHP 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE4NP_611326.1 GST_N_Delta_Epsilon 4..77 CDD:239343 19/53 (36%)
GstA 6..196 CDD:223698 50/187 (27%)
GST_C_Delta_Epsilon 91..209 CDD:198287 29/116 (25%)
gst-14NP_496861.1 GST_N_Sigma_like 4..75 CDD:239337 19/53 (36%)
PTZ00057 6..205 CDD:173353 51/189 (27%)
GST_C_Sigma_like 85..192 CDD:198301 29/119 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.