DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE4 and Gstz1

DIOPT Version :9

Sequence 1:NP_611326.1 Gene:GstE4 / 37109 FlyBaseID:FBgn0063496 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_034493.1 Gene:Gstz1 / 14874 MGIID:1341859 Length:216 Species:Mus musculus


Alignment Length:213 Identity:61/213 - (28%)
Similarity:98/213 - (46%) Gaps:31/213 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 GKISLYGLDASPPTRAC------LLTLKALDLPFEFVFVNLFEK--ENFSEDFSKKNPQHTVPLL 58
            ||..||....|    :|      .|.||.:|  :|.|.:||.:.  :.|:|:|...||...||.|
Mouse     4 GKPILYSYFRS----SCSWRVRIALALKGID--YEIVPINLIKDGGQQFTEEFQTLNPMKQVPAL 62

  Fly    59 QDDDACIWDSHAIMAYLVEKYAPSDELYPKDLLQRAKVDQLMH-FESGVIFESALRRLTRPVLFF 122
            :.|...|..|.|||.|| |:..|...|.|:|..:||.|..:.. ..||:   ..|:.|:  ||  
Mouse    63 KIDGITIVQSLAIMEYL-EETRPIPRLLPQDPQKRAIVRMISDLIASGI---QPLQNLS--VL-- 119

  Fly   123 GEPTLPRNQVDHILQV----YDFVETFLDD--HDFVAGDQLTIADFSIVSTITSIGVFLELDPAK 181
             :.....||:....:|    ::.:|..|..  ..:..||::::||..:|..:.:...| ::|.:.
Mouse   120 -KQVGQENQMQWAQKVITSGFNALEKILQSTAGKYCVGDEVSMADVCLVPQVANAERF-KVDLSP 182

  Fly   182 YPKIAAWLERLKELPYYE 199
            ||.|:...:.|..|..::
Mouse   183 YPTISHINKELLALEVFQ 200

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GstE4NP_611326.1 GST_N_Delta_Epsilon 4..77 CDD:239343 28/80 (35%)
GstA 6..196 CDD:223698 58/204 (28%)
GST_C_Delta_Epsilon 91..209 CDD:198287 26/116 (22%)
Gstz1NP_034493.1 GST_N_Zeta 6..80 CDD:239340 28/80 (35%)
maiA 7..211 CDD:273527 59/210 (28%)
Glutathione binding 14..19 2/8 (25%)