DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE4 and Gsto1

DIOPT Version :9

Sequence 1:NP_611326.1 Gene:GstE4 / 37109 FlyBaseID:FBgn0063496 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_034492.1 Gene:Gsto1 / 14873 MGIID:1342273 Length:240 Species:Mus musculus


Alignment Length:199 Identity:52/199 - (26%)
Similarity:91/199 - (45%) Gaps:15/199 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 GKISLYGLDASPPTRACLLTLKALDLPFEFVFVNLFEKENFSEDFSKKNPQHTVPLLQDDDA-CI 65
            |:|.:|.:...|..:..|:.|||..:..|.:.:||   :|..|.|.:|||...||:|::... .:
Mouse    22 GQIRVYSMRFCPFAQRTLMVLKAKGIRHEVININL---KNKPEWFFEKNPLGLVPVLENSQGHLV 83

  Fly    66 WDSHAIMAYLVEKYAPSDELYPKDLLQRAKVDQLMHFESGVIFESALRRLTRPVLFFGEPTLPRN 130
            .:|.....||.|.| |..:|:|.|..::|:  |.|..||.......:....|.......|.| |.
Mouse    84 TESVITCEYLDEAY-PEKKLFPDDPYKKAR--QKMTLESFSKVPPLIASFVRSKRKEDSPNL-RE 144

  Fly   131 QVDHILQVYDFVETFLDDH-DFVAGDQLTIADFSIVSTITSIGVFLELDP--AKYPKIAAWLERL 192
            .:::   .:..:|..:|:: .|:.||..::.|:........:.. |||..  |..||:..|:..:
Mouse   145 ALEN---EFKKLEEGMDNYKSFLGGDSPSMVDYLTWPWFQRLEA-LELKECLAHTPKLKLWMAAM 205

  Fly   193 KELP 196
            ::.|
Mouse   206 QQDP 209

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GstE4NP_611326.1 GST_N_Delta_Epsilon 4..77 CDD:239343 22/73 (30%)
GstA 6..196 CDD:223698 49/193 (25%)
GST_C_Delta_Epsilon 91..209 CDD:198287 23/109 (21%)
Gsto1NP_034492.1 GST_N_Omega 5..94 CDD:239353 22/74 (30%)
GstA 26..224 CDD:223698 50/195 (26%)