DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE4 and Gstt1

DIOPT Version :9

Sequence 1:NP_611326.1 Gene:GstE4 / 37109 FlyBaseID:FBgn0063496 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_032211.3 Gene:Gstt1 / 14871 MGIID:107379 Length:240 Species:Mus musculus


Alignment Length:233 Identity:74/233 - (31%)
Similarity:115/233 - (49%) Gaps:35/233 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 ISLYGLD-ASPPTRACLLTLKALDLPFEFVFVNLFEKENFSEDFSKKNPQHTVPLLQDDDACIWD 67
            :.|| || .|.|.||..:..|..::||:...|.|.:.|:.|:.|::.||...||.:.|....:.:
Mouse     3 LELY-LDLLSQPCRAIYIFAKKNNIPFQMHTVELRKGEHLSDAFARVNPMKRVPAMMDGGFTLCE 66

  Fly    68 SHAIMAYLVEKYAPSDELYPKDLLQRAKVDQLMHFESGVIFESALRRLTRPVL---FFGEPTLPR 129
            |.||:.||..||...|..||:||..||:||:.:.::...:..|.||.|...|:   |.||...|.
Mouse    67 SVAILLYLAHKYKVPDHWYPQDLQARARVDEYLAWQHTGLRRSCLRALWHKVMFPVFLGEQIPPE 131

  Fly   130 N------QVDHILQVYDFVETFLDDHDFVAGDQLTIADF-SIVSTITSIG----VFLELDPAKYP 183
            .      ::|..|||.:  :.||.|.||:.|..:::||. :|...:..:|    ||     ..:|
Mouse   132 TLAATLAELDVNLQVLE--DKFLQDKDFLVGPHISLADLVAITELMHPVGGGCPVF-----EGHP 189

  Fly   184 KIAAWLERLKELPYYEEANGKGAAQFVELLRSKNFTIV 221
            ::|||.:|:      |.|.||      :|.|..:..|:
Mouse   190 RLAAWYQRV------EAAVGK------DLFREAHEVIL 215

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GstE4NP_611326.1 GST_N_Delta_Epsilon 4..77 CDD:239343 26/73 (36%)
GstA 6..196 CDD:223698 67/204 (33%)
GST_C_Delta_Epsilon 91..209 CDD:198287 38/131 (29%)
Gstt1NP_032211.3 GstA 3..212 CDD:223698 73/228 (32%)
GST_N_Theta 3..78 CDD:239348 26/75 (35%)