DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE4 and GSTO2

DIOPT Version :9

Sequence 1:NP_611326.1 Gene:GstE4 / 37109 FlyBaseID:FBgn0063496 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_899062.1 Gene:GSTO2 / 119391 HGNCID:23064 Length:243 Species:Homo sapiens


Alignment Length:209 Identity:48/209 - (22%)
Similarity:83/209 - (39%) Gaps:39/209 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 GKISLYGLDASPPTRACLLTLKALDLPFEFVFVNLFEKENFSEDFSKKNPQHTVPLLQDDDA-CI 65
            |.|.:|.:...|.:....|.|||.|:..|.|.:||   .|..|.:..|:|...:|:|:.... .|
Human    22 GLIRIYSMRFCPYSHRTRLVLKAKDIRHEVVNINL---RNKPEWYYTKHPFGHIPVLETSQCQLI 83

  Fly    66 WDSHAIMAYLVEKYAPSDELYPKDLLQRAKVDQLMHFESGVIFESALRRLTRPVLFFGEPTLPR- 129
            ::|.....||.:.| |..:|:|.|..:||:...|:.                  ||...|.|.: 
Human    84 YESVIACEYLDDAY-PGRKLFPYDPYERARQKMLLE------------------LFCKVPHLTKE 129

  Fly   130 ------------NQVDHILQVYDFVETFLD--DHDFVAGDQLTIADFSIVSTITSIGVFLELDPA 180
                        |....:.|.:..:|..|:  :..|..|..:::.|:.:......:.|:..||..
Human   130 CLVALRCGRECTNLKAALRQEFSNLEEILEYQNTTFFGGTCISMIDYLLWPWFERLDVYGILDCV 194

  Fly   181 KY-PKIAAWLERLK 193
            .: |.:..|:..:|
Human   195 SHTPALRLWISAMK 208

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GstE4NP_611326.1 GST_N_Delta_Epsilon 4..77 CDD:239343 22/73 (30%)
GstA 6..196 CDD:223698 46/205 (22%)
GST_C_Delta_Epsilon 91..209 CDD:198287 20/119 (17%)
GSTO2NP_899062.1 Thioredoxin_like 7..94 CDD:320948 22/74 (30%)