DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment GstE4 and CLIC2

DIOPT Version :9

Sequence 1:	NP_611326.1	Gene:	GstE4 / 37109	FlyBaseID:	FBgn0063496	Length:	222	Species:	Drosophila melanogaster
Sequence 2:	NP_001280.3	Gene:	CLIC2 / 1193	HGNCID:	2063	Length:	247	Species:	Homo sapiens

Alignment Length:	69	Identity:	20/69 - (28%)
Similarity:	34/69 - (49%)	Gaps:	19/69 - (27%)

- Green bases have known domain annotations that are detailed below.

  Fly   140 DFVET-FLDDHD-------------FVAGDQLTIADFSIVSTITSIGV----FLELD-PAKYPKI 185
            |::.| .||:.|             |:.|||||:||.|::..:..|.|    :.:.| ||::..:
Human   148 DYLNTPLLDEIDPDSAEEPPVSRRLFLDGDQLTLADCSLLPKLNIIKVAAKKYRDFDIPAEFSGV 212

  Fly   186 AAWL 189
            ..:|
Human   213 WRYL 216

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
GstE4	NP_611326.1	GST_N_Delta_Epsilon	4..77	CDD:239343
		GstA	6..196	CDD:223698	20/69 (29%)
		GST_C_Delta_Epsilon	91..209	CDD:198287	20/69 (29%)
CLIC2	NP_001280.3	Required for insertion into the membrane. /evidence=ECO:0000250	1..96
		N-terminal	1..94
		O-ClC	12..245	CDD:129941	20/69 (29%)
		Joint loop	95..106
		C-terminal	107..247		20/69 (29%)
		Foot loop	151..171		4/19 (21%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	1	0.930	-	-		C165154403
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	2	1.840