DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE4 and clic6

DIOPT Version :9

Sequence 1:NP_611326.1 Gene:GstE4 / 37109 FlyBaseID:FBgn0063496 Length:222 Species:Drosophila melanogaster
Sequence 2:XP_002941923.2 Gene:clic6 / 100486547 XenbaseID:XB-GENE-6039572 Length:831 Species:Xenopus tropicalis


Alignment Length:219 Identity:49/219 - (22%)
Similarity:82/219 - (37%) Gaps:52/219 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 ISLY---GLDAS-----PPTRACLLTLKALDLPFEFVFVNLFEKENFSEDFSKKNPQHTVPLLQD 60
            |||:   |.|..     |.::...:.|....:.|....|:|..|   ..|.....|....|.:..
 Frog   598 ISLFVKAGSDGESIGNCPFSQRLFMILWLKGVVFNVTTVDLKRK---PADLQNLAPGTNPPFMTF 659

  Fly    61 DDACIWDSHAIMAYLVE--------KYAP--------SDELYPK--DLLQRAKVDQLMHFESGVI 107
            |.....|.:.|..:|.|        |.||        .::::.|  ..::..:.|.....|.|  
 Frog   660 DGEVKTDVNKIEEFLEERLTMPRYPKLAPKHPESSSAGNDVFAKFSAYIKNPRKDLNAALEKG-- 722

  Fly   108 FESALRRLTRPVLFFGEPTLPRNQVDHILQVYDFVETFLDDHDFVAGDQLTIADFSIVSTITSIG 172
            |..:||:|..   |...| || :::|    .|...:..:.|..|:.|::||:||.:::..:..| 
 Frog   723 FLRSLRKLDD---FLNTP-LP-DEID----AYSTEDITISDRKFLDGNELTLADCNLLPKLQII- 777

  Fly   173 VFLELDPAKYPKIAAWLERLKELP 196
                       |:.|...|..|:|
 Frog   778 -----------KVVAKKYRNFEIP 790

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE4NP_611326.1 GST_N_Delta_Epsilon 4..77 CDD:239343 18/80 (23%)
GstA 6..196 CDD:223698 46/215 (21%)
GST_C_Delta_Epsilon 91..209 CDD:198287 26/106 (25%)
clic6XP_002941923.2 PHA03418 <8..131 CDD:177646
GST_N_CLIC 595..683 CDD:239359 19/87 (22%)
O-ClC 598..831 CDD:129941 49/219 (22%)
GST_C_CLIC6 690..829 CDD:198334 27/124 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.