DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE3 and Clic5

DIOPT Version :9

Sequence 1:NP_611325.2 Gene:GstE3 / 37108 FlyBaseID:FBgn0063497 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_446055.1 Gene:Clic5 / 94272 RGDID:620659 Length:251 Species:Rattus norvegicus


Alignment Length:213 Identity:48/213 - (22%)
Similarity:74/213 - (34%) Gaps:63/213 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 GIDGS-----PPVRSVLLTLRALNLDFDYKIVNLMEKEHLKPEFLKINPLHTVPALDDNGFYLAD 67
            ||||.     |..:.:.:.|....:.|:...|:|..|   ..:...:.|....|.|..||....|
  Rat    23 GIDGESIGNCPFSQRLFMILWLKGVVFNVTTVDLKRK---PADLHNLAPGTHPPFLTFNGDVKTD 84

  Fly    68 SHAINSYLVSKYGRNDSLYPKDLKKRAIVDQRLHYDSSVVTSTGRAITFPLF--------WENKT 124
            .:.|..:|      .::|.|:...|.|    ..|.:|    :|.....|..|        .:|..
  Rat    85 VNKIEEFL------EETLTPEKYPKLA----ARHRES----NTAGIDIFSKFSAYIKNTKQQNNA 135

  Fly   125 EIPQARIDALEGVYKSLNLFL-----------ENGN---YLAGDNLTIAD------FHVI----- 164
            .:.:....||..:...||..|           |.|:   :|.||.||:||      .||:     
  Rat   136 ALERGLTKALRKLDDYLNTPLPEEIDTNTHGDEKGSQRKFLDGDELTLADCNLLPKLHVVKIVAK 200

  Fly   165 --------AGLTGFFVFL 174
                    |.:||.:.:|
  Rat   201 KYRNYDIPAEMTGLWRYL 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE3NP_611325.2 GstA 4..195 CDD:223698 48/213 (23%)
GST_N_Delta_Epsilon 4..77 CDD:239343 18/73 (25%)
GST_C_Delta_Epsilon 91..208 CDD:198287 28/125 (22%)
Clic5NP_446055.1 Required for insertion into the membrane. /evidence=ECO:0000250 1..98 19/83 (23%)
O-ClC 14..249 CDD:129941 48/213 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166348300
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.