DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE3 and URE2

DIOPT Version :9

Sequence 1:NP_611325.2 Gene:GstE3 / 37108 FlyBaseID:FBgn0063497 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_014170.1 Gene:URE2 / 855492 SGDID:S000005173 Length:354 Species:Saccharomyces cerevisiae


Alignment Length:241 Identity:61/241 - (25%)
Similarity:96/241 - (39%) Gaps:60/241 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 TLYGIDGSPPVRSVLLTLRALNLDFDYKIVNLMEKEHLKPEFLKINPLHTVPALDDNG---FYLA 66
            ||:....:|....|.:.|..|...::...::....||..|||:.:||...||||.|:|   ..:.
Yeast   115 TLFSHRSAPNGFKVAIVLSELGFHYNTIFLDFNLGEHRAPEFVSVNPNARVPALIDHGMDNLSIW 179

  Fly    67 DSHAINSYLVSKYGR---NDSLYPKDLKKRAIVDQRLHYDSS-VVTSTGRAITFPLFWENKTEIP 127
            :|.||..:||:||.:   |..|:..||..::.::..|.:.:| .....|:|:.|..|...|....
Yeast   180 ESGAILLHLVNKYYKETGNPLLWSDDLADQSQINAWLFFQTSGHAPMIGQALHFRYFHSQKIASA 244

  Fly   128 QAR-IDALEGVY-----------KSLNLFLENGN---------------------YLAGDNLTIA 159
            ..| .|.:..||           ::|.:.|:..|                     :|.||.||||
Yeast   245 VERYTDEVRRVYGVVEMALAERREALVMELDTENAAAYSAGTTPMSQSRFFDYPVWLVGDKLTIA 309

  Fly   160 DFHVIAGLTGFFVFLP----VD------ATKYPELAAWIKRIKELP 195
            |          ..|:|    ||      ..::||:..|.|.:...|
Yeast   310 D----------LAFVPWNNVVDRIGINIKIEFPEVYKWTKHMMRRP 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE3NP_611325.2 GstA 4..195 CDD:223698 60/239 (25%)
GST_N_Delta_Epsilon 4..77 CDD:239343 23/74 (31%)
GST_C_Delta_Epsilon 91..208 CDD:198287 31/149 (21%)
URE2NP_014170.1 GST_N_Ure2p_like 114..194 CDD:239346 26/78 (33%)
GST_C_Ure2p 208..350 CDD:198326 31/148 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
TreeFam 00.000 Not matched by this tool.
65.710

Return to query results.
Submit another query.