DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE3 and GTT1

DIOPT Version :9

Sequence 1:NP_611325.2 Gene:GstE3 / 37108 FlyBaseID:FBgn0063497 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_012304.1 Gene:GTT1 / 854856 SGDID:S000001477 Length:234 Species:Saccharomyces cerevisiae


Alignment Length:241 Identity:60/241 - (24%)
Similarity:95/241 - (39%) Gaps:56/241 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LTLYGIDGSPPVRSVLLTLRALNLDFDYKIVNLMEKEHLK--PEFLKINPLHTVPALD----DNG 62
            :.::.:|.|...| :|..|..|||  :|:||......:.:  ||..||:||...|.|:    :.|
Yeast     6 IKVHWLDHSRAFR-LLWLLDHLNL--EYEIVPYKRDANFRAPPELKKIHPLGRSPLLEVQDRETG 67

  Fly    63 --FYLADSHAINSYLVSKYGRNDSLYPKDLKKRAIVDQ----------------RLHYDSSVVTS 109
              ..||:|..|..|::..:..:..|..:|..   |.||                .:.:..|.|..
Yeast    68 KKKILAESGFIFQYVLQHFDHSHVLMSEDAD---IADQINYYLFYVEGSLQPPLMIEFILSKVKD 129

  Fly   110 TGRAITFPLFW---ENKTEIPQA--------RIDALEGVYKSLNLFLENGNYLAGDNLTIADFHV 163
            :|  :.||:.:   :...:|.||        :.|.:||...      :|..||....|:.||..:
Yeast   130 SG--MPFPISYLARKVADKISQAYSSGEVKNQFDFVEGEIS------KNNGYLVDGKLSGADILM 186

  Fly   164 IAGLTGFF---VFLPVDATKYPELAAWIKRI-KELPYYEEANGSRA 205
            ...|...|   ...|.|   ||.::.|:|.| .|..|......:||
Yeast   187 SFPLQMAFERKFAAPED---YPAISKWLKTITSEESYAASKEKARA 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE3NP_611325.2 GstA 4..195 CDD:223698 57/229 (25%)
GST_N_Delta_Epsilon 4..77 CDD:239343 25/80 (31%)
GST_C_Delta_Epsilon 91..208 CDD:198287 33/146 (23%)
GTT1NP_012304.1 GST_N_GTT1_like 6..87 CDD:239344 25/83 (30%)
GST_C_GTT1_like 93..218 CDD:198298 30/138 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.