DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE3 and YGR201C

DIOPT Version :9

Sequence 1:NP_611325.2 Gene:GstE3 / 37108 FlyBaseID:FBgn0063497 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_011717.4 Gene:YGR201C / 853115 SGDID:S000003433 Length:225 Species:Saccharomyces cerevisiae


Alignment Length:202 Identity:52/202 - (25%)
Similarity:88/202 - (43%) Gaps:27/202 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 VRSVLLTLRALNLDFDYKIVNLMEKEHL-KPEFLKINPLHTVPAL--DDNGFYLADSHAINSYLV 76
            :|:::......:|..|.|:.:..:.:.| :.||    ||...|..  ..:.:.|.::.||:.||:
Yeast    16 IRTIVPRGLVRSLKLDVKLADPSDAQQLYEREF----PLRKYPTFVGPHDEWTLTEAMAIDYYLI 76

  Fly    77 ----SKYGRNDSLYPK-DLKKRAIVDQRLHYDSSVVTSTGRAITFPLFW---ENKTEIPQAR--I 131
                .|......|.|: |.|.||.:.:.....:|...:....:.|||..   .|.||...||  :
Yeast    77 HLSSDKEAVRQLLGPEGDFKTRADILRWESLSNSDFLNEVCEVFFPLIGVKPYNATEFKAARENV 141

  Fly   132 DALEGVYKSLNLFLENGNYL-AGDNLTIADFHVIAGLT-GFFVFLPVDAT---KYPELAAWIKRI 191
            |.:..:|:..   |:...|| ..|:.|:||....|..: ||..|.  |.|   |:||:..|..|:
Yeast   142 DTIVSLYEKR---LKKQQYLVCDDHETLADLISAAAFSLGFISFF--DETWRSKHPEVTRWFNRV 201

  Fly   192 KELPYYE 198
            .:..::|
Yeast   202 IKSRFFE 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE3NP_611325.2 GstA 4..195 CDD:223698 51/197 (26%)
GST_N_Delta_Epsilon 4..77 CDD:239343 15/68 (22%)
GST_C_Delta_Epsilon 91..208 CDD:198287 33/118 (28%)
YGR201CNP_011717.4 Thioredoxin_like 4..78 CDD:412351 15/65 (23%)
GST_C_EF1Bgamma_like 98..220 CDD:198290 32/116 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157345079
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.