Sequence 1: | NP_611325.2 | Gene: | GstE3 / 37108 | FlyBaseID: | FBgn0063497 | Length: | 220 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_011717.4 | Gene: | YGR201C / 853115 | SGDID: | S000003433 | Length: | 225 | Species: | Saccharomyces cerevisiae |
Alignment Length: | 202 | Identity: | 52/202 - (25%) |
---|---|---|---|
Similarity: | 88/202 - (43%) | Gaps: | 27/202 - (13%) |
- Green bases have known domain annotations that are detailed below.
Fly 15 VRSVLLTLRALNLDFDYKIVNLMEKEHL-KPEFLKINPLHTVPAL--DDNGFYLADSHAINSYLV 76
Fly 77 ----SKYGRNDSLYPK-DLKKRAIVDQRLHYDSSVVTSTGRAITFPLFW---ENKTEIPQAR--I 131
Fly 132 DALEGVYKSLNLFLENGNYL-AGDNLTIADFHVIAGLT-GFFVFLPVDAT---KYPELAAWIKRI 191
Fly 192 KELPYYE 198 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
GstE3 | NP_611325.2 | GstA | 4..195 | CDD:223698 | 51/197 (26%) |
GST_N_Delta_Epsilon | 4..77 | CDD:239343 | 15/68 (22%) | ||
GST_C_Delta_Epsilon | 91..208 | CDD:198287 | 33/118 (28%) | ||
YGR201C | NP_011717.4 | Thioredoxin_like | 4..78 | CDD:412351 | 15/65 (23%) |
GST_C_EF1Bgamma_like | 98..220 | CDD:198290 | 32/116 (28%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C157345079 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0625 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.740 |