DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE3 and clic3

DIOPT Version :9

Sequence 1:NP_611325.2 Gene:GstE3 / 37108 FlyBaseID:FBgn0063497 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_955818.1 Gene:clic3 / 84040 ZFINID:ZDB-GENE-010507-2 Length:239 Species:Danio rerio


Alignment Length:198 Identity:44/198 - (22%)
Similarity:81/198 - (40%) Gaps:33/198 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 VLLTLRALNLDFDYKIVNLMEKEHLKPEFLK-INPLHTVPALDDNGFYLADSHAINSYLVSKYGR 81
            ::|.|:.:|  |....|::..    .||.|| :.|....|.|..||....|::.|..:|      
Zfish    31 MILWLKGVN--FTLTTVDMKR----APEVLKDLAPGSQPPFLIYNGEVRTDTNKIEEFL------ 83

  Fly    82 NDSLYPKDLKK--------RAIVDQRLHYDSSVVTSTGRAITFPL---FWENKTEIPQARIDAL- 134
            .|:|.|....|        ....|...|..|:.:.:....:...|   |.::..::.|..:..| 
Zfish    84 EDTLAPPQYPKLCCRYKESNTAGDDIFHKFSAYIKNPNPGLNDMLEKKFLKSLMKLDQYLLTPLP 148

  Fly   135 EGVYKSLNLFLENGNYLAGDNLTIADFHVIAGLTGFFVFLPVDATKYP--ELAAWIKRIKELPYY 197
            ..:.::..|.....:||.|:.|::||.:::..|.    .:.|...||.  |:.|.:|.:.:  |.
Zfish   149 HELDQNPELSTSTRHYLDGNALSLADCNLLPKLH----IVKVVCKKYRGFEIPAELKGLSK--YL 207

  Fly   198 EEA 200
            ::|
Zfish   208 DKA 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE3NP_611325.2 GstA 4..195 CDD:223698 42/191 (22%)
GST_N_Delta_Epsilon 4..77 CDD:239343 17/59 (29%)
GST_C_Delta_Epsilon 91..208 CDD:198287 24/124 (19%)
clic3NP_955818.1 GST_N_CLIC 3..92 CDD:239359 20/72 (28%)
O-ClC 6..237 CDD:129941 44/198 (22%)
GST_C_CLIC3 99..231 CDD:198332 23/118 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589611
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.