DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE3 and GSTF6

DIOPT Version :9

Sequence 1:NP_611325.2 Gene:GstE3 / 37108 FlyBaseID:FBgn0063497 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_001184893.1 Gene:GSTF6 / 839515 AraportID:AT1G02930 Length:208 Species:Arabidopsis thaliana


Alignment Length:216 Identity:61/216 - (28%)
Similarity:93/216 - (43%) Gaps:35/216 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGKLTLYGIDGSPPVRSVLLTLRALNLDFDYKIVNLMEKEHLKPEFLKINPLHTVPALDDNGFYL 65
            |..:.::|...|...|.||:.|...|:||::..|.|.:.||.|..|:..||...|||.:|..|.:
plant     1 MAGIKVFGHPASTATRRVLIALHEKNVDFEFVHVELKDGEHKKEPFILRNPFGKVPAFEDGDFKI 65

  Fly    66 ADSHAINSYLVSKY---GRNDSLYPKDLKKRAIVDQRLHYDSSVVTSTGRAITFPLFWE------ 121
            .:|.||..|:..::   |.|.....||:   ||:...:..:|......|.    .|.||      
plant    66 FESRAITQYIAHEFSDKGNNLLSTGKDM---AIIAMGIEIESHEFDPVGS----KLVWEQVLKPL 123

  Fly   122 -----NKT--EIPQARIDALEGVYKSLNLFLENGNYLAGDNLTIADFHVIAGLTGFFVFLPVDAT 179
                 :||  |..:|::..:..||:..   |....|||.|:.|:.|.|.|..:.    :|....|
plant   124 YGMTTDKTVVEEEEAKLAKVLDVYEHR---LGESKYLASDHFTLVDLHTIPVIQ----YLLGTPT 181

  Fly   180 K-----YPELAAWIKRIKELP 195
            |     .|.::||:..|...|
plant   182 KKLFDERPHVSAWVADITSRP 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE3NP_611325.2 GstA 4..195 CDD:223698 59/211 (28%)
GST_N_Delta_Epsilon 4..77 CDD:239343 26/72 (36%)
GST_C_Delta_Epsilon 91..208 CDD:198287 30/123 (24%)
GSTF6NP_001184893.1 GST_N_Phi 4..77 CDD:239351 26/72 (36%)
GST_C_Phi 91..208 CDD:198296 32/126 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.770

Return to query results.
Submit another query.