DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE3 and GSTF5

DIOPT Version :9

Sequence 1:NP_611325.2 Gene:GstE3 / 37108 FlyBaseID:FBgn0063497 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_001322019.1 Gene:GSTF5 / 839479 AraportID:AT1G02940 Length:281 Species:Arabidopsis thaliana


Alignment Length:243 Identity:63/243 - (25%)
Similarity:97/243 - (39%) Gaps:60/243 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LYGIDGSPPVRSVLLTLRALNLDFDYKIVNLMEKEHLKPEFLKINPLHTVPALDDNGFYLADSHA 70
            :||...|...|.||..|....|.:|...|||:..:..||.||.|||...||...|.|..|.:|.|
plant    66 IYGYPYSTNTRRVLAVLHEKGLSYDPITVNLIAGDQKKPSFLAINPFGQVPVFLDGGLKLTESRA 130

  Fly    71 INSYLVSKYGRNDSLYPKDLKKRAIVDQRLHYDSSVVTSTGR-----------AITFPLFWE--- 121
            |:.|:.:.:           |.|.  .|.|:|.|.....|.|           .:|..|.||   
plant   131 ISEYIATVH-----------KSRG--TQLLNYKSYKTMGTQRMWMAIESFEFDPLTSTLTWEQSI 182

  Fly   122 -------------NKTEIPQARIDALEGVYKSLNLFLENGNYLAGDNLTIADFHVIAGLTGFFVF 173
                         |:||   |:::.:..:|:..   |:|.::||.::.|:||.:.:..:.    :
plant   183 KPMYGLKTDYKVVNETE---AKLEKVLDIYEER---LKNSSFLASNSFTMADLYHLPNIQ----Y 237

  Fly   174 LPVDATK-----YPELAAWIKRIKELPYYEEANGSRAAQIIEFIKSKK 216
            |....||     .|.:..|:..|...|.::     ||..:..:...||
plant   238 LMDTHTKRMFVNRPSVRRWVAEITARPAWK-----RACDVKAWYHKKK 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE3NP_611325.2 GstA 4..195 CDD:223698 58/220 (26%)
GST_N_Delta_Epsilon 4..77 CDD:239343 28/70 (40%)
GST_C_Delta_Epsilon 91..208 CDD:198287 33/148 (22%)
GSTF5NP_001322019.1 GST_N_Phi 65..136 CDD:239351 28/69 (41%)
GST_C_Phi 153..270 CDD:198296 26/131 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.770

Return to query results.
Submit another query.