DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE3 and GSTF4

DIOPT Version :9

Sequence 1:NP_611325.2 Gene:GstE3 / 37108 FlyBaseID:FBgn0063497 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_001320441.1 Gene:GSTF4 / 838240 AraportID:AT1G02950 Length:255 Species:Arabidopsis thaliana


Alignment Length:210 Identity:47/210 - (22%)
Similarity:77/210 - (36%) Gaps:38/210 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 YGIDGSP---PVRSVLLTLRALNLDFDYKIVNLMEKEHLKPEFLKINPLHTVPALDDNGFYLADS 68
            |.:.|.|   ..|.||..|....|.::...|.|...||....||.:||...||..:|....|.:|
plant    37 YKVHGDPFSTNTRRVLAVLHEKRLSYEPITVKLQTGEHKTEPFLSLNPFGQVPVFEDGSVKLYES 101

  Fly    69 HAINSYLVSKYGRNDSLYPKDLKKRAIVDQRLH----------------YDSSVVTSTGRAITFP 117
            .||..|:.         |....:...:::.|.|                :|......|...:..|
plant   102 RAITQYIA---------YVHSSRGTQLLNLRSHETMATLTMWMEIEAHQFDPPASKLTWEQVIKP 157

  Fly   118 LFWENKTEIPQARIDALEGVY-KSLNLF---LENGNYLAGDNLTIADFHVIAGLTGFFVFLPVDA 178
            ::   ..|..|..:...|.:. |.||::   ||...:||.::.|:.|.|.:..:. :.:..|...
plant   158 IY---GLETDQTIVKENEAILEKVLNIYEKRLEESRFLACNSFTLVDLHHLPNIQ-YLLGTPTKK 218

  Fly   179 --TKYPELAAWIKRI 191
              .|..::..|:..|
plant   219 LFEKRSKVRKWVDEI 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE3NP_611325.2 GstA 4..195 CDD:223698 47/210 (22%)
GST_N_Delta_Epsilon 4..77 CDD:239343 24/72 (33%)
GST_C_Delta_Epsilon 91..208 CDD:198287 22/123 (18%)
GSTF4NP_001320441.1 GST_N_Phi 38..109 CDD:239351 23/70 (33%)
GST_C_Phi 126..243 CDD:198296 20/112 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 40 1.000 Domainoid score I4833
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.770

Return to query results.
Submit another query.