DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE3 and GSTT2

DIOPT Version :9

Sequence 1:NP_611325.2 Gene:GstE3 / 37108 FlyBaseID:FBgn0063497 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_198940.3 Gene:GSTT2 / 834125 AraportID:AT5G41240 Length:591 Species:Arabidopsis thaliana


Alignment Length:222 Identity:64/222 - (28%)
Similarity:102/222 - (45%) Gaps:30/222 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KLTLYGIDGSPPVRSVLLTLRALNLDFDYKIVNLMEKEHLKPEFLKINPLHTVPALDDNGFYLAD 67
            ||.:|....|.|.|:||:..:...:.||..:::|.:::.|.|||.:|||:..|||:.|....|.:
plant     2 KLKVYADRMSQPSRAVLIFCKVNEIQFDEILISLGKRQQLSPEFKEINPMGKVPAIVDGRLKLFE 66

  Fly    68 SHAINSYLVSKYGR-NDSLYPKDLKKRAIVDQRLHYDSS---------VVTST-GRAITFPLFWE 121
            ||||..||.|.|.. .|..||.||.|||.:...|.:..:         |:.|. ..|:..||   
plant    67 SHAILIYLSSAYASVVDHWYPNDLSKRAKIHSVLDWHHTNLRPGASGYVLNSVLAPALGLPL--- 128

  Fly   122 NKTEIPQARIDA---LEGVYKSLNLFLENGN---YLAGDNLTIADFHVIAGLTGFFVFLPVDATK 180
                .|:|..:|   |.....:|..|...|:   .|.|...:|||..::..|....|....|..:
plant   129 ----NPKAAAEAENILTNSLSTLETFWLKGSAKFLLGGKQPSIADLSLVCELMQLQVLDDKDRLR 189

  Fly   181 ----YPELAAWIKRIKE--LPYYEEAN 201
                :.::..||:..::  :|:.:|.:
plant   190 LLSPHKKVEQWIESTRKATMPHSDEVH 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE3NP_611325.2 GstA 4..195 CDD:223698 61/213 (29%)
GST_N_Delta_Epsilon 4..77 CDD:239343 28/72 (39%)
GST_C_Delta_Epsilon 91..208 CDD:198287 28/133 (21%)
GSTT2NP_198940.3 GST_N_Theta 3..78 CDD:239348 29/74 (39%)
GST_C_Theta 92..221 CDD:198292 28/132 (21%)
NAM-associated 380..>515 CDD:405060
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.720

Return to query results.
Submit another query.