DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE3 and GSTT3

DIOPT Version :9

Sequence 1:NP_611325.2 Gene:GstE3 / 37108 FlyBaseID:FBgn0063497 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_198938.1 Gene:GSTT3 / 834124 AraportID:AT5G41220 Length:590 Species:Arabidopsis thaliana


Alignment Length:222 Identity:69/222 - (31%)
Similarity:107/222 - (48%) Gaps:30/222 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KLTLYGIDGSPPVRSVLLTLRALNLDFDYKIVNLMEKEHLKPEFLKINPLHTVPALDDNGFYLAD 67
            ||.:|....|.|.|:||:..:...:.||..::.|..::.|.|||..|||:..|||:.|....|::
plant     2 KLKVYADRMSQPSRAVLIFCKVNEIQFDEILIYLANRQQLSPEFKDINPMGKVPAIVDGKLKLSE 66

  Fly    68 SHAINSYLVSKY-GRNDSLYPKDLKKRAIVDQRLHYDSS---------VVTST-GRAITFPLFWE 121
            ||||..||.|.| ...|..||.||.|||.:...|.:..:         |:.|. |.|:..||   
plant    67 SHAILIYLSSAYPSVVDHWYPTDLSKRARIHSVLDWHHTNLRPGAAGYVLNSVLGPALGLPL--- 128

  Fly   122 NKTEIPQARIDALEGVYKS---LNLFLENGN--YLAGDNL-TIADFHVIAGLTGFFVFLPVDATK 180
                .|:|..:|.:.:.||   |:.|...||  :|.|.|. :|||..::..||...|....|..:
plant   129 ----NPKAAAEAEQLLTKSLTTLDTFWLKGNAMFLLGSNQPSIADLSLVCELTQLQVLDDKDRLR 189

  Fly   181 ----YPELAAWIKRIKE--LPYYEEAN 201
                :..:..||:..::  :|:::|.:
plant   190 LLSPHKNVEQWIENTRKATMPHFDEVH 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE3NP_611325.2 GstA 4..195 CDD:223698 66/213 (31%)
GST_N_Delta_Epsilon 4..77 CDD:239343 28/72 (39%)
GST_C_Delta_Epsilon 91..208 CDD:198287 33/133 (25%)
GSTT3NP_198938.1 PLN02473 1..202 CDD:166114 66/206 (32%)
GST_N_Theta 3..78 CDD:239348 29/74 (39%)
GST_C_Theta 92..221 CDD:198292 33/132 (25%)
NAM-associated 378..>455 CDD:291001
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.720

Return to query results.
Submit another query.