DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE3 and GSTT1

DIOPT Version :9

Sequence 1:NP_611325.2 Gene:GstE3 / 37108 FlyBaseID:FBgn0063497 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_198937.1 Gene:GSTT1 / 834123 AraportID:AT5G41210 Length:245 Species:Arabidopsis thaliana


Alignment Length:225 Identity:69/225 - (30%)
Similarity:109/225 - (48%) Gaps:32/225 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGKLTLYGIDGSPPVRSVLLTLRALNLDFDYKIVNLMEKEHLKPEFLKINPLHTVPALDDNGFYL 65
            |.||.:|....|.|.|:|::..:...:.||..:::|.:::.|.|||..||||..|||:.|....|
plant     1 MMKLKVYADRMSQPSRAVIIFCKVNGIQFDEVLISLAKRQQLSPEFKDINPLGKVPAIVDGRLKL 65

  Fly    66 ADSHAINSYLVSKY-GRNDSLYPKDLKKRAIVDQRLHYDSS---------VVTST-GRAITFPLF 119
            .:||||..||.|.: ...|..||.||.|||.:...|.:..:         |:.|. |.|:..|| 
plant    66 FESHAILIYLSSAFPSVADHWYPNDLSKRAKIHSVLDWHHTNLRRGAAGYVLNSVLGPALGLPL- 129

  Fly   120 WENKTEIPQARIDALEGVYKSLNLFLE------NGNYLAGDNL-TIADFHVIAGLTGFFVFLPVD 177
                  .|:|..:|.:.:.|||:. ||      |..:|.|.|. :|||..::..|....|....|
plant   130 ------NPKAAAEAEQLLTKSLST-LETFWLKGNAKFLLGSNQPSIADLSLVCELMQLQVLDDKD 187

  Fly   178 ATK----YPELAAWIKRIKE--LPYYEEAN 201
            ..:    :.::..||:..|:  :|:::|.:
plant   188 RLRLLSTHKKVEQWIENTKKATMPHFDETH 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE3NP_611325.2 GstA 4..195 CDD:223698 65/214 (30%)
GST_N_Delta_Epsilon 4..77 CDD:239343 28/72 (39%)
GST_C_Delta_Epsilon 91..208 CDD:198287 33/134 (25%)
GSTT1NP_198937.1 GST_N_Theta 4..79 CDD:239348 29/74 (39%)
GST_C_Theta 93..223 CDD:198292 33/133 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.720

Return to query results.
Submit another query.