DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE3 and GSTF2

DIOPT Version :9

Sequence 1:NP_611325.2 Gene:GstE3 / 37108 FlyBaseID:FBgn0063497 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_192161.1 Gene:GSTF2 / 827931 AraportID:AT4G02520 Length:212 Species:Arabidopsis thaliana


Alignment Length:217 Identity:58/217 - (26%)
Similarity:93/217 - (42%) Gaps:25/217 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGKLTLYGIDGSPPVRSVLLTLRALNLDFDYKIVNLMEKEHLKPEFLKINPLHTVPALDDNGFYL 65
            |..:.::|...|...|.||:.|...||||:...|.|.:.||.|..||..||...|||.:|....|
plant     1 MAGIKVFGHPASIATRRVLIALHEKNLDFELVHVELKDGEHKKEPFLSRNPFGQVPAFEDGDLKL 65

  Fly    66 ADSHAINSYLVSKY---GRN----DSLYPKDLKKRAIVDQRLHYDSSVVTSTGRAITFPLFW--- 120
            .:|.||..|:..:|   |.|    ||   |::.:.||:...:..:..........:.|...:   
plant    66 FESRAITQYIAHRYENQGTNLLQTDS---KNISQYAIMAIGMQVEDHQFDPVASKLAFEQIFKSI 127

  Fly   121 ------ENKTEIPQARIDALEGVYKSLNLFLENGNYLAGDNLTIADFHVIAGLTGFFVFLPVDA- 178
                  |......:|::..:..||::.   |:...||||:..|:.|.|.|..:. :.:..|... 
plant   128 YGLTTDEAVVAEEEAKLAKVLDVYEAR---LKEFKYLAGETFTLTDLHHIPAIQ-YLLGTPTKKL 188

  Fly   179 -TKYPELAAWIKRIKELPYYEE 199
             |:.|.:..|:..|.:.|..|:
plant   189 FTERPRVNEWVAEITKRPASEK 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE3NP_611325.2 GstA 4..195 CDD:223698 55/208 (26%)
GST_N_Delta_Epsilon 4..77 CDD:239343 28/72 (39%)
GST_C_Delta_Epsilon 91..208 CDD:198287 23/120 (19%)
GSTF2NP_192161.1 GST_N_Phi 4..78 CDD:239351 28/73 (38%)
GST_C_Phi 96..211 CDD:198296 23/119 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.770

Return to query results.
Submit another query.