DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE3 and ATGSTF13

DIOPT Version :9

Sequence 1:NP_611325.2 Gene:GstE3 / 37108 FlyBaseID:FBgn0063497 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_191835.1 Gene:ATGSTF13 / 825451 AraportID:AT3G62760 Length:219 Species:Arabidopsis thaliana


Alignment Length:217 Identity:66/217 - (30%)
Similarity:96/217 - (44%) Gaps:37/217 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LTLYGIDGSPPVRSVLLTLRALNLDFDYKIVNLMEKEHLKPEFLKINPLHTVPALDDNGFYLADS 68
            :.|||.:.|..|..|||.|...|.:|:...|||....|..|.||.:||...||||.|:...|.:|
plant     3 MKLYGDEMSACVARVLLCLHEKNTEFELVPVNLFACHHKLPSFLSMNPFGKVPALQDDDLTLFES 67

  Fly    69 HAINSYLVSKY--GRNDSLYPKDLKKRAIVD-----QRLHYDSSVVTSTGRAITFPLFWENKTEI 126
            .||.:|:..|:  ...|....:|.|:.|||.     :..|::.::.....:.|..||    :.|.
plant    68 RAITAYIAEKHRDKGTDLTRHEDPKEAAIVKLWSEVEAHHFNPAISAVIHQLIVVPL----QGES 128

  Fly   127 PQARI--DALEGVYKSLNLF---LENGNYLAGDNLTIADFH-----------VIAGLTGFFVFLP 175
            |.|.|  :.||.:.|.|:::   |....|||||..|:||.|           :.|||        
plant   129 PNAAIVEENLENLGKILDVYEERLGKTKYLAGDTYTLADLHHVPYTYYFMKTIHAGL-------- 185

  Fly   176 VDATKYPELAAWIKRIKELPYY 197
              ....|.:.||.:.:...|.:
plant   186 --INDRPNVKAWWEDLCSRPAF 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE3NP_611325.2 GstA 4..195 CDD:223698 65/213 (31%)
GST_N_Delta_Epsilon 4..77 CDD:239343 30/72 (42%)
GST_C_Delta_Epsilon 91..208 CDD:198287 33/128 (26%)
ATGSTF13NP_191835.1 PLN02395 1..209 CDD:166036 66/217 (30%)
GST_N_Phi 2..77 CDD:239351 30/73 (41%)
GST_C_Phi 92..208 CDD:198296 33/128 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
98.870

Return to query results.
Submit another query.