DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE3 and GSTF11

DIOPT Version :9

Sequence 1:NP_611325.2 Gene:GstE3 / 37108 FlyBaseID:FBgn0063497 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_186969.1 Gene:GSTF11 / 821227 AraportID:AT3G03190 Length:214 Species:Arabidopsis thaliana


Alignment Length:214 Identity:57/214 - (26%)
Similarity:93/214 - (43%) Gaps:31/214 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LYG-IDGSPPVRSVLLTLRALNLDFDYKIVNLMEKEHLKPEFLKINPLHTVPALDDNGFYLADSH 69
            :|| |..:.|.| |||.....:::|:...|:|.:.|..||:.|...|...|||::|....|.:|.
plant     5 VYGQIKAANPQR-VLLCFLEKDIEFEVIHVDLDKLEQKKPQHLLRQPFGQVPAIEDGYLKLFESR 68

  Fly    70 AINSYLVSKYG-RNDSLYPKDLKKRAIVDQRLHYDSSVVTSTGRAITFPLFWENKTEIP------ 127
            ||..|..:||. :...|..|.|:.||||||.:..:::...:....:...:.::.|:..|      
plant    69 AIARYYATKYADQGTDLLGKTLEGRAIVDQWVEVENNYFYAVALPLVMNVVFKPKSGKPCDVALV 133

  Fly   128 ---QARIDALEGVYKSLNLFLENGNYLAGDNLTIADFHVIAG---------LTGFFVFLPVDATK 180
               :.:.|.:..||::.   |....||.||..|:||...:.|         |:|.       .|.
plant   134 EELKVKFDKVLDVYENR---LATNRYLGGDEFTLADLSHMPGMRYIMNETSLSGL-------VTS 188

  Fly   181 YPELAAWIKRIKELPYYEE 199
            ...|..|...|...|.:::
plant   189 RENLNRWWNEISARPAWKK 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE3NP_611325.2 GstA 4..195 CDD:223698 56/208 (27%)
GST_N_Delta_Epsilon 4..77 CDD:239343 25/71 (35%)
GST_C_Delta_Epsilon 91..208 CDD:198287 27/127 (21%)
GSTF11NP_186969.1 PLN02473 1..214 CDD:166114 57/214 (27%)
GST_N_Phi 2..77 CDD:239351 25/72 (35%)
GST_C_Phi 91..209 CDD:198296 27/127 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.860

Return to query results.
Submit another query.