DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE3 and GSTF10

DIOPT Version :9

Sequence 1:NP_611325.2 Gene:GstE3 / 37108 FlyBaseID:FBgn0063497 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_180644.1 Gene:GSTF10 / 817637 AraportID:AT2G30870 Length:215 Species:Arabidopsis thaliana


Alignment Length:222 Identity:55/222 - (24%)
Similarity:95/222 - (42%) Gaps:40/222 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LTLYGIDGSPPVRSVLLTLRALNLDFDYKIVNLMEKEHLKPEFLKINPLHTVPALDDNGFYLADS 68
            ||:|....:...|:| :||....:.|:...|:||:.|..:||:|.|.|...:|.|.|..:.:.:|
plant     3 LTIYAPLFASSKRAV-VTLVEKGVSFETVNVDLMKGEQRQPEYLAIQPFGKIPVLVDGDYKIFES 66

  Fly    69 HAINSYLVSKY-GRNDSLYPKDLKKRAIVDQRL-----HYDSSVVTSTGRAITFPLFW----ENK 123
            .||..|:..|| .:...|..|.:::|..|:|.|     .|...::..|...:..||..    |..
plant    67 RAIMRYIAEKYRSQGPDLLGKTIEERGQVEQWLDVEATSYHPPLLALTLNIVFAPLMGFPADEKV 131

  Fly   124 TEIPQARIDALEGVYKSLNLFLENGNYLAGDNLTIADFHVIAGLTGFFVFLPVDATKY------- 181
            .:..:.::..:..||::.   |....|||||.:::||          ...||.  |:|       
plant   132 IKESEEKLAEVLDVYEAQ---LSKNEYLAGDFVSLAD----------LAHLPF--TEYLVGPIGK 181

  Fly   182 -------PELAAWIKRIKELPYYEEAN 201
                   ..::||..:|.....::|.:
plant   182 AHLIKDRKHVSAWWDKISSRAAWKEVS 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE3NP_611325.2 GstA 4..195 CDD:223698 54/214 (25%)
GST_N_Delta_Epsilon 4..77 CDD:239343 24/72 (33%)
GST_C_Delta_Epsilon 91..208 CDD:198287 27/134 (20%)
GSTF10NP_180644.1 PLN02395 1..215 CDD:166036 55/222 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 40 1.000 Domainoid score I4833
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.870

Return to query results.
Submit another query.