DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE3 and GSTF9

DIOPT Version :9

Sequence 1:NP_611325.2 Gene:GstE3 / 37108 FlyBaseID:FBgn0063497 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_180643.1 Gene:GSTF9 / 817636 AraportID:AT2G30860 Length:215 Species:Arabidopsis thaliana


Alignment Length:210 Identity:55/210 - (26%)
Similarity:96/210 - (45%) Gaps:20/210 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LTLYGIDGSPPVRSVLLTLRALNLDFDYKIVNLMEKEHLKPEFLKINPLHTVPALDDNGFYLADS 68
            |.:||...:.|.|: |:||....:.|:...|:||:.||.:|.:|.:.|..||||:.|..:.:.:|
plant     3 LKVYGPHFASPKRA-LVTLIEKGVAFETIPVDLMKGEHKQPAYLALQPFGTVPAVVDGDYKIFES 66

  Fly    69 HAINSYLVSKY-GRNDSLYPKDLKKRAIVDQRLHYDSSVVTSTGRAITFPLFWENKTEIP----- 127
            .|:..|:..|| .:...|..|.::.|..|:|.|..:::........:|..:.:.:....|     
plant    67 RAVMRYVAEKYRSQGPDLLGKTVEDRGQVEQWLDVEATTYHPPLLNLTLHIMFASVMGFPSDEKL 131

  Fly   128 -QARIDALEGVYKSLNLFLENGNYLAGDNLTIADF-HVIAGLTGFFV------FLPVDATKYPEL 184
             :...:.|.||.......|....|||||.:::||. |:  ..|.:.|      ::..|.   ..:
plant   132 IKESEEKLAGVLDVYEAHLSKSKYLAGDFVSLADLAHL--PFTDYLVGPIGKAYMIKDR---KHV 191

  Fly   185 AAWIKRIKELPYYEE 199
            :||...|...|.::|
plant   192 SAWWDDISSRPAWKE 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE3NP_611325.2 GstA 4..195 CDD:223698 53/204 (26%)
GST_N_Delta_Epsilon 4..77 CDD:239343 25/72 (35%)
GST_C_Delta_Epsilon 91..208 CDD:198287 26/122 (21%)
GSTF9NP_180643.1 PLN02395 1..215 CDD:166036 55/210 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 40 1.000 Domainoid score I4833
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.870

Return to query results.
Submit another query.