DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE3 and GSTF3

DIOPT Version :9

Sequence 1:NP_611325.2 Gene:GstE3 / 37108 FlyBaseID:FBgn0063497 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_178394.1 Gene:GSTF3 / 814822 AraportID:AT2G02930 Length:212 Species:Arabidopsis thaliana


Alignment Length:226 Identity:62/226 - (27%)
Similarity:91/226 - (40%) Gaps:43/226 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGKLTLYGIDGSPPVRSVLLTLRALNLDFDYKIVNLMEKEHLKPEFLKINPLHTVPALDDNGFYL 65
            |..:.::|...|...|.||:.|...||||:...|.|.:.||.|..||..||...|||.:|....|
plant     1 MAGIKVFGHPASTSTRRVLIALHEKNLDFELVHVELKDGEHKKEPFLSRNPFGQVPAFEDGDLKL 65

  Fly    66 ADSHAINSYLVSKY-GRNDSLYPKDLKKRAIVDQRLHYDSSVVTSTG--------RAITFPLFWE 121
            .:|.||..|:..:| .:..:|.|.|.|..|         ...:.|.|        ..:...|.||
plant    66 FESRAITQYIAHRYENQGTNLLPADSKNIA---------QYAIMSIGIQVEAHQFDPVASKLAWE 121

  Fly   122 NKTEI-------------PQARIDALEGVYKSLNLFLENGNYLAGDNLTIADFH---VIAGLTGF 170
            ...:.             .:|::..:..||::.   |:...||||:..|:.|.|   ||..|.| 
plant   122 QVFKFNYGLNTDQAVVAEEEAKLAKVLDVYEAR---LKEFKYLAGETFTLTDLHHIPVIQYLLG- 182

  Fly   171 FVFLPVDA--TKYPELAAWIKRIKELPYYEE 199
               .|...  |:.|.:..|:..|.:.|..|:
plant   183 ---TPTKKLFTERPRVNEWVAEITKRPASEK 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE3NP_611325.2 GstA 4..195 CDD:223698 59/217 (27%)
GST_N_Delta_Epsilon 4..77 CDD:239343 28/72 (39%)
GST_C_Delta_Epsilon 91..208 CDD:198287 29/135 (21%)
GSTF3NP_178394.1 PLN02473 4..212 CDD:166114 61/223 (27%)
GST_N_Phi 4..78 CDD:239351 28/73 (38%)
GST_C_Phi 96..212 CDD:198296 27/122 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.770

Return to query results.
Submit another query.