DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE3 and GDAP1L1

DIOPT Version :10

Sequence 1:NP_611325.2 Gene:GstE3 / 37108 FlyBaseID:FBgn0063497 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_001243666.1 Gene:GDAP1L1 / 78997 HGNCID:4213 Length:386 Species:Homo sapiens


Alignment Length:89 Identity:23/89 - (25%)
Similarity:39/89 - (43%) Gaps:5/89 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LTLYGIDGSPPVRSVLLTLRALNLDFDYKIVNLMEKEHLKPEFLKINPLHTVPALDDNGFYLADS 68
            |.||....|...:.|.|.:....|..:.:.|:|.:.||.:|.|:::|....||.:......::|.
Human    47 LVLYHWTQSFSSQKVRLVIAEKGLVCEERDVSLPQSEHKEPWFMRLNLGEEVPVIIHRDNIISDY 111

  Fly    69 HAINSYLVSKY-----GRNDSLYP 87
            ..|..|:...:     ||..|.:|
Human   112 DQIIDYVERTFTGGGRGRCPSGFP 135

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE3NP_611325.2 GstA 4..200 CDD:440390 23/89 (26%)
GDAP1L1NP_001243666.1 GST_N_GDAP1 47..119 CDD:239350 19/71 (27%)
GST_C_GDAP1L1 220..330 CDD:198335
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.