DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE3 and Clic3

DIOPT Version :9

Sequence 1:NP_611325.2 Gene:GstE3 / 37108 FlyBaseID:FBgn0063497 Length:220 Species:Drosophila melanogaster
Sequence 2:XP_030107910.1 Gene:Clic3 / 69454 MGIID:1916704 Length:268 Species:Mus musculus


Alignment Length:216 Identity:48/216 - (22%)
Similarity:77/216 - (35%) Gaps:65/216 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 IDGSPPVRSVLLTLRALNL---------------DFDYKIVNLMEKEHLK-----PEFLKINPLH 53
            :.|.|...:.:.|.|||::               |.|.|...|..:|.|:     |:|..:.|.:
Mouse    66 LKGVPFTLTTVDTRRALDVLKDFAPGSQLPILLYDGDVKTDTLQIEEFLEETLGPPDFPSLAPRY 130

  Fly    54 TVPALDDNGFYLADSHAINSYLVSKYGRND-SLYPKDLKKRAIVDQRLHYDSSVVTSTGRAITFP 117
            .......|..:    |..::::.:.....| :||.:.|:....:|..|           ||   |
Mouse   131 RESNTAGNDIF----HKFSAFIKNPVPTQDNALYQQLLRALTRLDSYL-----------RA---P 177

  Fly   118 LFWENKTEIPQARIDALEGVYKSLNLFLENGNYLAGDNLTIAD------FHVIAGLTGFFVFLPV 176
            |..|...| |..|        :|...||:      ||..|:||      .|::..:...|..||:
Mouse   178 LDHELAQE-PHLR--------ESHRRFLD------GDQFTLADCSLLPKLHIVDTVCAHFRQLPI 227

  Fly   177 DA-----TKYPELAAWIKRIK 192
            .|     .:|.:.|...|..|
Mouse   228 PAELSCVRRYLDSALQKKEFK 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE3NP_611325.2 GstA 4..195 CDD:223698 48/216 (22%)
GST_N_Delta_Epsilon 4..77 CDD:239343 17/87 (20%)
GST_C_Delta_Epsilon 91..208 CDD:198287 27/113 (24%)
Clic3XP_030107910.1 O-ClC 43..261 CDD:129941 48/216 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167844728
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.