DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE3 and GSTT2B

DIOPT Version :9

Sequence 1:NP_611325.2 Gene:GstE3 / 37108 FlyBaseID:FBgn0063497 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_001074312.1 Gene:GSTT2B / 653689 HGNCID:33437 Length:244 Species:Homo sapiens


Alignment Length:197 Identity:58/197 - (29%)
Similarity:95/197 - (48%) Gaps:25/197 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 SPPVRSVLLTLRALNLDFDYKIVNLMEKEHLKPEFLKINPLHTVPALDDNGFYLADSHAINSYLV 76
            |.|.|:|.:..:...:..:.:.|:|::.:|...|||:||.|..:|.|.|..|.|.:|.||..||.
Human    11 SQPSRAVYIFAKKNGIPLELRTVDLVKGQHKSKEFLQINSLGKLPTLKDGDFILTESSAILIYLS 75

  Fly    77 SKYGRNDSLYPKDLKKRAIVDQRLHYDSSVVTSTGRAITFPLFWEN------KTEIPQARID--- 132
            .||...|..||.||:.||.|.:.|.:.:..:..|   ...|| |..      ..::|:.:::   
Human    76 CKYQTPDHWYPSDLQARARVHEYLGWHADCIRGT---FGIPL-WVQVLGPLIGVQVPEEKVERNR 136

  Fly   133 -ALEGVYKSL-NLFLENGNYLAGDNLTIADFHVIAGL-----TGFFVFLPVDATKYPELAAWIKR 190
             |::...:.| :.||.:..:|||..:|:||...:..|     .|:.:|     ...|.||||..|
Human   137 TAMDQALQWLEDKFLGDRPFLAGQQVTLADLMALEELMQPVALGYELF-----EGRPRLAAWRGR 196

  Fly   191 IK 192
            ::
Human   197 VE 198

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GstE3NP_611325.2 GstA 4..195 CDD:223698 58/197 (29%)
GST_N_Delta_Epsilon 4..77 CDD:239343 23/64 (36%)
GST_C_Delta_Epsilon 91..208 CDD:198287 28/118 (24%)
GSTT2BNP_001074312.1 GST_N_Theta 3..78 CDD:239348 23/66 (35%)