DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE3 and gstt1a

DIOPT Version :9

Sequence 1:NP_611325.2 Gene:GstE3 / 37108 FlyBaseID:FBgn0063497 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_001314691.1 Gene:gstt1a / 563972 ZFINID:ZDB-GENE-031001-13 Length:242 Species:Danio rerio


Alignment Length:218 Identity:71/218 - (32%)
Similarity:108/218 - (49%) Gaps:29/218 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LTLYGIDGSPPVRSVLLTLRALNLDFDYKIVNLMEKEHLKPEFLKINPLHTVPALDDNGFYLADS 68
            |.||....|.|.|||.:..:...:.|:||.|:|...|....||.|::.:..||||.|..|.|.:|
Zfish     3 LELYLDLHSQPCRSVFIFAKINKIPFEYKAVDLSAGEQYGDEFGKVSIIRKVPALKDGDFLLTES 67

  Fly    69 HAINSYLVSKYGRNDSLYPKDLKKRAIVDQRLHYDSSVVTSTGRAITFPLFW-------ENKTEI 126
            .||..||..|:...|..||.||:|||.||:.|.:..:.:.|.|..:    ||       .....:
Zfish    68 IAILLYLAGKHSTPDHWYPADLQKRAQVDEFLSWQHTNIRSHGSKV----FWFKGVLPAVTGAPV 128

  Fly   127 PQARID-ALEGVYKSLNL----FLENGNYLAGDNLTIADFHVIAGL-----TGFFVFLPVDATKY 181
            |:.::| |||.:..||.:    ||::..::.||.:::||...|..:     ||..||     ...
Zfish   129 PKEKMDSALEDLNMSLKIFEDKFLQSRPFIIGDKISLADIVAIVEMMQPVATGVDVF-----EGR 188

  Fly   182 PELAAWIKRIKE---LPYYEEAN 201
            |.|:||..|:|:   :..::||:
Zfish   189 PALSAWRDRVKKEVGVELFDEAH 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE3NP_611325.2 GstA 4..195 CDD:223698 69/210 (33%)
GST_N_Delta_Epsilon 4..77 CDD:239343 29/72 (40%)
GST_C_Delta_Epsilon 91..208 CDD:198287 36/131 (27%)
gstt1aNP_001314691.1 GstA 3..199 CDD:223698 68/204 (33%)
GST_N_Theta 3..78 CDD:239348 29/74 (39%)
GST_C_Theta 91..217 CDD:198292 36/130 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.720

Return to query results.
Submit another query.